KEGG   Asticcacaulis excentricus: Astex_1018Help
Entry
Astex_1018        CDS       T01378                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aex  Asticcacaulis excentricus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Astex_1018
  Lipid metabolism
   00561 Glycerolipid metabolism
    Astex_1018
   00600 Sphingolipid metabolism
    Astex_1018
Enzymes [BR:aex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Astex_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1066446..1067660
Genome map
AA seq 404 aa AA seqDB search
MKTTAWLLAAGLSVSLCLGGGVVSAQAHETLKLEAPKPNLLPAPPMGWNSWNKYACNITE
DIVRKQADAMAASGLKEAGYQYIVIDDCWQKSRDADGNIQVDLERFPSGMKALIDYVHSK
GLKFGLYSDAGSLTCGGRPGSAGHEFQDARQYARWGVDYLKYDWCYTGTRDAEAAYTIMA
KALRSSGRDIVLSICEWGDNYPQRWAAPIGHLWRTTGDIYDAWEGKKGYSIGMVNILDKQ
VDLWRYSGPNRWNDPDMLEVGNGGMTTTEYESHFSLWAMLAAPLIAGNDLSNMDADTLRI
LTNTDVIAVDQDPLGQQAKRIWKEGDLEVWARPLKGGDQAVVLFNRSAAPAEMSVTWEQL
NLPAGLKVQVKDLWSKKVTKNVKARFGGTVASHGVIMARLTPTI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaccgcctggttgctggccgctggcctgagtgtgagtctgtgtctggggggc
ggtgtcgttagcgcacaggcgcacgagactctgaagctggaggcgccgaagcccaacctg
ttgccggccccgccgatggggtggaattcgtggaacaaatacgcctgcaatatcactgag
gacatcgtgcgcaagcaggccgatgccatggcggcgtcaggcctcaaggaggcgggctat
cagtatatcgtcatcgacgactgctggcagaaaagccgcgatgccgacgggaatattcag
gtcgatctggaacgctttccgtccggcatgaaggccctgatcgactatgtgcatagtaag
gggctgaagttcggcctctattccgacgccggttcgctgacctgcggcggccgtccgggc
agtgccggtcatgagtttcaggacgcccgccaatacgcgcgatggggcgtcgattacctg
aaatacgactggtgctacaccggcacgcgcgatgcagaagcggcctatacgattatggcc
aaggcgctgcgctcgtccgggcgcgatatcgtcctgtcgatctgtgagtggggcgacaac
tatccgcagcgctgggccgcgcccatcggtcacctgtggcgcaccaccggcgacatctat
gacgcctgggagggcaaaaagggctattcgatcggcatggtcaacattctcgacaagcag
gtggacctgtggcgctattccggcccgaaccgctggaacgatcccgacatgctcgaagtc
ggcaatggcggcatgacgacgaccgaatacgagtcgcatttctcgctgtgggctatgctg
gccgcgccgctgatcgccgggaacgacctgtccaatatggacgccgatacgctgcgcatc
ctaaccaacaccgacgttatcgccgtcgatcaggacccgctggggcagcaggccaaacgc
atctggaaagagggcgatctcgaagtctgggcgcgtccgctgaaaggcggcgatcaagcg
gtggtgctgtttaaccgcagtgccgccccggcggagatgagcgtcacatgggaacagctc
aacctgccggccggactgaaggttcaggtcaaagacctgtggtccaaaaaggtgacgaaa
aacgtcaaggcgcgctttggtggcaccgtggcttcgcacggcgtgatcatggcccgcttg
actccaactatttga

DBGET integrated database retrieval system