KEGG   Asticcacaulis excentricus: Astex_1033Help
Entry
Astex_1033        CDS       T01378                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
aex  Asticcacaulis excentricus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aex00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:aex00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:aex02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1081692..1083254
Genome map
AA seq 520 aa AA seqDB search
MMTTDLTRRSLMAAAASAVLVPPAWSQAAPPFTLGVASGDPWDDGFVIWTRLAPDPLAAD
GLGGLSAPVAVRWFVYEDAAGRHVVQRGEVMTHPRSAHTVHVTLRDLQPDRPYWYRFEAL
GAQSPMGRGRTLPQAAAQVRELRLAMASCSHYEVGYFSAYRHMAAENPDYVLFLGDYIYE
FSFSDPKRKVRHHDQMADATDLAGYRNRYALYRTDADLQTLHATISCLMTWDDHEVENDY
GGLLPQDVAEDPGFLKRRLAAYQAFYEHMPLRRESRLKGQNLRLYKGYRFGRLAEINMLD
GRQYRSAPACPTPTSRKGRVVGDDCPQRLDPKRTMLGFAQERWLFDRFKQSKARWNLMGQ
DLLAASLRQKGKDSEGRAIVGHWTDGWDGYPATRDRMIAAMQAMRLSNPVLLGGDIHSYW
ATELKANPLDPASRSVATEFVGTSITYDGPPYEVFADMLPENPHVKYFESRRRGYVSLTV
RPEALEARFQVISDRRDPNATLSTLASFVVEHGKPAIQRI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaccgatttaacccgccgaagcttgatggcggcagcggcgagcgctgttctt
gtgcccccggcatggtcgcaggccgcaccgccctttacacttggggtcgcgtccggtgat
ccgtgggacgatggttttgtcatctggacgcgtctggcgcctgatccgctggcggccgat
gggttgggtggattgagcgcgccggtggcggtgcgctggttcgtctatgaggatgcggcg
ggccgtcacgtcgtgcaacggggtgaggtgatgacccacccgcgttcggcccatacggtg
cacgtcacgttgcgtgatctgcaacccgatcggccctactggtatcgttttgaggcgctg
ggggcgcaaagcccgatgggccgggggcgcaccctgccgcaagccgccgcgcaggtgcgt
gaactcaggctcgccatggcctcgtgttcgcactatgaagtcggctatttcagcgcctac
cgccatatggcggcggaaaatccggactatgtgctgttccttggcgactatatctacgag
ttcagtttcagcgatcccaaacgcaaggtgcgccaccacgatcagatggcggacgccacc
gatctggccggttatcgaaaccgctacgcgctttatcgaacggatgcggaccttcagacg
ctgcacgcgacgatctcctgcctgatgacgtgggacgaccacgaggtcgaaaacgactat
gggggtctgctgccgcaggacgtggccgaagatcccggtttcctgaagcggcggctggcg
gcgtatcaggccttttatgaacacatgcccttgcgccgcgagtcccgcctgaaagggcaa
aatctgaggttatacaaaggctatcgcttcgggcggctggcggaaatcaatatgctggac
ggccgacagtatcgttcggccccggcctgcccgaccccgacgagccgaaaggggcgggtg
gtcggcgatgactgccctcagcggctcgaccccaaacgcaccatgctgggctttgcgcag
gagcggtggttgtttgaccgcttcaaacagtcaaaggcgcgttggaatctgatggggcag
gaccttctggcggcgtcactgcgtcagaagggtaaggactctgaagggcgggcgattgtg
gggcactggaccgatggctgggatggctatccggcgacgcgcgatcgtatgattgcggcc
atgcaggcgatgcgcctgtccaatccggtcttactgggcggagatattcactcctactgg
gccaccgaactgaaggccaatccactggacccggcgtcacgatcagtcgctacggaattc
gtcgggacatcgattacctatgacgggccaccctatgaggtgtttgctgatatgctgcct
gaaaatccgcatgtgaaatattttgaaagtcgccgccggggctatgtctctctgaccgtc
cgccctgaggcgctggaggcgcggtttcaggtgatttcggaccgccgcgaccccaacgcc
acgctttcgaccctggcgagttttgtcgtcgaacacggaaaaccggccattcagcgcata
tag

DBGET integrated database retrieval system