KEGG   Asticcacaulis excentricus: Astex_1079Help
Entry
Astex_1079        CDS       T01378                                 

Definition
3-hydroxyacyl-CoA dehydrogenase nad-binding protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
aex  Asticcacaulis excentricus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Astex_1079
   01212 Fatty acid metabolism
    Astex_1079
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Astex_1079
   00650 Butanoate metabolism
    Astex_1079
  Lipid metabolism
   00071 Fatty acid degradation
    Astex_1079
   01040 Biosynthesis of unsaturated fatty acids
    Astex_1079
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Astex_1079
   00310 Lysine degradation
    Astex_1079
   00380 Tryptophan metabolism
    Astex_1079
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Astex_1079
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Astex_1079
   00281 Geraniol degradation
    Astex_1079
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Astex_1079
Enzymes [BR:aex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Astex_1079
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Astex_1079
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Astex_1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1127869..1130091
Genome map
AA seq 740 aa AA seqDB search
MECFKTELDADGILLCTFDVPGKTMNTFTKQALADLQAIAERAKTDAEVKGVVITSGKTT
GFCAGADLEEMLGGAWEAKSDPNDPEGALKAGFAAAFEMNRVYRQLETCGKPVAVALNGL
ALGGGLELALACHYRVLNDGPKTQVGLPEIKIGLFPGGGGSQRLTRLIGAQAALMAMSEG
KSFKPKDALSAGIVHEVVPVGQEIEAAKNWIKTKGDPVALWDKKDYKLPGGGPYHPAGAQ
IFIMANALLRKQSYGNYPAVVNLMRAVYEGLQLPFDSAIKVESRYFVNTLQTPQAKAMIR
TFFFSMQQLGKGSGRPAGVEKTDPKQVAVLGAGMMGAGIAYVSAQAGIRVILIDRDQAAA
DKGKAHCEGLVKKAVSRGKMTQERAQALLDLIVATPDYTQIAGSDLVVEAVFENTELKEK
VTKDAEAKLYTGDKAETAIFGTNTSTIPISLLAKASVDASKFIGIHFFSPVDKMMLVEII
RGKETSDETLAKAIDYVLKIRKTPIVVNDARFFYANRCFIPFTAEGLHLWAEGYAPALID
NVGRATGMPRGPLEMMDDVALDLLVKITSETAKAMGDAYVPIPGEKEVAQMVADGRLGRK
NGKGFYDYPEAGGNKSLWPGLSDKFTPTITDSTPELAEDIRKRLLYIQAVTAARCFEEGV
ISDPREADVGSILGWGFAPWSGGIVSLIDAIGTAKFVEELDELTVKYGDRFNPPQLLRDM
AAKGETFYGRFGKTDSAKAA
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcttcaaaaccgaactcgacgccgatggcatcctgctctgcaccttcgatgtg
ccgggcaagaccatgaacacctttaccaaacaggccttggccgacctgcaggccattgcc
gaacgcgccaaaaccgacgctgaggtcaagggcgtggtgatcacgtcgggcaagacgacc
ggcttctgcgccggggccgaccttgaagaaatgctgggcggggcgtgggaagccaagtca
gacccgaacgatcccgagggcgcgttgaaggcgggttttgccgccgcctttgagatgaac
cgcgtctatcgtcaactggaaacctgcggcaagccggtggccgtagcgctcaacggcctg
gcgctgggtggcggtctggaactggcgctcgcctgtcactaccgcgtgctgaacgacggt
ccaaagacgcaagtgggcctgccggaaatcaagatcggcctcttccccggcggtggtggt
tcgcaacgactgacgcgcctgatcggggcgcaggccgcgcttatggccatgtcagaaggc
aagagcttcaagccgaaggacgccctgtccgccggtattgtgcatgaggtggtgccggtc
ggtcaggagatcgaggcggccaagaactggatcaagaccaagggagaccccgtcgccctg
tgggataagaaggactacaagcttcccggtggcggaccctaccatccggcgggcgcgcaa
atcttcattatggcaaatgccctgctacgtaagcagtcctatggcaactatcccgccgtg
gtgaacctgatgcgcgccgtctatgaaggcctgcaactgcctttcgacagcgccataaag
gtcgaaagccgctacttcgtcaacaccctgcaaaccccgcaggccaaggcgatgatccgc
accttcttcttctccatgcagcaactgggcaagggctccggccgtccggcaggcgtggaa
aagaccgacccgaagcaggtggcggttctgggcgctggcatgatgggggcggggattgcc
tatgtctcggcgcaggccggtatccgcgtcatcctgatcgaccgcgatcaggccgctgcc
gacaagggcaaggcgcactgcgaaggtctggtcaaaaaagccgtatcgcgcggcaagatg
acccaggaaagggcgcaggccctcctcgacctgatcgtggcgacaccggactacacgcag
attgccggttccgatctggtggtcgaagcggtgttcgaaaacaccgaactgaaggaaaag
gtcaccaaggacgccgaggccaagctctatacgggcgataaggccgagacggcgatcttt
ggcaccaatacctcgaccatccccatctcgctgcttgccaaggcttcggtcgatgcctcg
aaattcatcggcatccacttcttctcgccggtggacaagatgatgctggtcgaaatcatc
cgcggcaaggagacgtcggacgagactctggctaaggctatcgactacgtgctcaagatc
cgtaagacgccgatcgtcgtcaatgatgcgcgcttcttctacgccaaccgctgcttcatc
ccgttcaccgccgaaggcctgcacctgtgggccgaaggctatgccccggcgctcatcgac
aatgtcggtcgggccacgggtatgccacgcgggccgctggagatgatggacgatgtggcg
ctcgaccttttggtcaagatcacctctgaaaccgccaaggcgatgggcgacgcctatgtg
cccatccccggcgaaaaggaggtggcgcagatggtcgccgacgggcgtctgggccgcaag
aacggcaagggcttctacgactatccggaagcggggggtaataagagcctgtggccgggt
ctatcggacaagttcacgcccaccatcaccgattcgacgccggagctggccgaagatatc
cgcaagcgcctgctttatattcaggcggtgacggcggcgcgctgcttcgaggagggtgtc
atcagcgacccacgcgaagccgatgtcggctcgatcctcggctggggctttgcgccgtgg
tcgggcgggatcgtctcgctgatcgacgccatcggtacggcgaagtttgtcgaggaactg
gacgaactgacggtcaaatacggtgaccgctttaacccgccgcaattgttgcgtgatatg
gcggcgaagggcgaaaccttctacggacggttcggaaagaccgattcagccaaggcagcg
taa

DBGET integrated database retrieval system