KEGG   Asticcacaulis excentricus: Astex_1225Help
Entry
Astex_1225        CDS       T01378                                 

Definition
glycoside hydrolase family 2 tim barrel
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
aex  Asticcacaulis excentricus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Astex_1225
  Lipid metabolism
   00600 Sphingolipid metabolism
    Astex_1225
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Astex_1225
Enzymes [BR:aex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Astex_1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1279990..1283112)
Genome map
AA seq 1040 aa AA seqDB search
MGSVAAGVMMLAAAPVLAQTAPVAEWEQPEVVAVNREPMKATFFNFESRDLALKGDKSAS
TRFLSLDGTWDFKFSKGVDNRPKDFYKAGANLSGWDKIQVPGMIQAQGDGKFGLPEFFNI
KYPFPANEPFIPHDMIEVGSYKRSFEVAADWTGQDVFLHIGAAGAAYYIWVNGEKVGYSE
DSKLPSEFNVTKFLKSGHNEIALEIYRYADGSYLEDQDFWRLSGIERSVYLYAEPKTRLR
DFTVRATLDKTYTDGVFALEAELAGQKGAATVTATVYDGETQVLKTTSKASVGKPAQLSG
TLKGVKAWTAETPNLYRLVIELTDAKGNLISATAKKIGFRTVEIRNGEVQVNGKRILIKG
VNRHEHDPKTYRVMTPELMRKDVELMKQANVNALRTSHYPNDPYLYDLADEYGLYIMDEA
NIESHEYMDTADRKAAQANDPKIREQIQLGYKPHWANAHLDRISRMVERDKNHPSIIFWS
LGNEAGTGPNFENAARWIRQNDPTRLISYLGHGTLYGDHQPNPYVDIYAPMYDDIDRIND
YAEDPRYAQPLIQCEYAHAMGNSLGNLEDYWVAIRAKKKLQGGFVWDFIDQFVDGTDSKG
RHYWASGFDVNPQRGDNSVVGDGLVQADRTPDPEYYELQKVYSPVTFEGAPQSGKVTVIN
RHNFRDLSGFDFTWTLLKDGVVADRGTLGGVNAAPDSSSDVALSLPALPQDGAEYIVTLA
AIAKNDSIRGVPAHSTVGWSQFVLRPASAAAEATAFVKPQQEGKAITLSAAGRTLSIDAD
TGLIALDSDGKTLLKGGTPNFWRGLTDNDEGANVARNHGIWKSLTENRRVRDLKVEADRV
QVLFVHGPGQVKVTVTYRLRTNGKVMVTTDFDPIKDDLPDPLRVGLRFDTDPSLANLEWY
GRGPQESYVDRQTGYAIGRYKGTVAEQFHDYARPQETGNKTEVRWIAVSDASGKGVKVTG
AQPLSANALAFPYEDLYARPRGEWRAADVTPRGDGTLLIDLAQIGVGGDTGWSQEARSLV
KYRIPLKPQTYSFTIETTVP
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atgggctcggtggcggcgggggtgatgatgctcgccgcagcgcccgtactggcgcaaacc
gcgcccgtggcggaatgggagcagcctgaggtggtggcggtgaaccgcgagccgatgaag
gcgaccttcttcaatttcgagagccgtgatcttgcgctgaagggcgacaaatcggcctca
acgcgctttttgtcgctggatggcacctgggatttcaaattctccaaaggtgtcgataat
cgcccgaaagatttctacaaagccggcgcgaacctgagcggctgggataagattcaggtc
cccggcatgattcaggcgcagggcgacggcaagttcggcctgccggaattcttcaatatc
aaatatcccttcccggcgaatgagcccttcatcccgcacgatatgatcgaggtgggctcg
tacaagcgtagcttcgaggtggccgcggattggaccggtcaggatgtgtttttgcatatc
ggcgcggcgggtgcggcctattacatctgggtcaatggcgagaaggtcggctattcggaa
gattctaagctgccgtccgaattcaatgtgacgaagttcctcaagtctggtcacaatgag
atcgcactggaaatctaccggtatgccgatggttcttaccttgaggatcaggacttctgg
cggctgtcggggattgagcgctcggtctatctttatgcggagcccaaaacgcgcctgcgc
gatttcacggtgcgcgccaccctcgacaagacctatacagacggcgtctttgcgctggag
gccgaactggcgggtcagaaaggtgcggccacagtgactgccaccgtctatgacggcgag
acgcaggtgctgaaaaccacgagcaaggccagtgtcggcaagcccgcgcaactgagcggc
acactcaagggcgtcaaggcgtggacggcggagacgcccaacctttaccggctggtgatc
gagctcaccgacgccaagggcaatctgatctcggccaccgcgaagaagatcggcttccgc
acggtggaaatccgcaatggcgaggtccaggtcaatggcaagcgcatcctgatcaaaggc
gtcaaccgccacgagcacgacccgaagacctaccgcgtcatgacgccggagctaatgcgc
aaggatgtcgagctgatgaagcaggccaatgtcaatgcgctgcgcacctcgcactatccc
aacgacccgtatctctacgacctcgctgacgaatatggcctctatatcatggacgaggcc
aatatcgagagccatgaatatatggacaccgccgacaggaaggcggcgcaggccaacgac
ccgaaaatccgcgagcagatccagctgggttacaagccgcactgggccaatgctcacctc
gaccgcatttctcgcatggttgaacgcgacaagaaccacccgtcgatcatcttctggtcg
ctcggcaatgaggcaggcaccgggccaaactttgaaaatgcggccaggtggattcgccag
aacgatccgacgcgcctgatctcctacttgggccatggcaccctgtacggcgatcatcag
cccaacccctatgtcgatatttacgcgccgatgtacgacgatatcgaccgcatcaacgac
tatgccgaagacccgcgctacgcccagccgctgatccagtgcgaatacgcccacgccatg
ggcaacagcctcggcaatcttgaagattactgggtcgccatccgcgccaaaaagaagctg
caaggcggcttcgtctgggacttcattgatcagttcgtggacggcacggactccaaaggc
cgtcactactgggcctcaggcttcgatgtgaacccgcaacgtggcgacaattcggtggtg
ggtgacgggttggtgcaggctgaccgtaccccggacccggaatattacgagcttcagaag
gtctattcgccggtcaccttcgaaggcgcaccgcagtcgggtaaggtcacggtcatcaac
cgtcacaatttccgtgacctgtcgggctttgactttacatggaccttgctgaaggacggc
gtggtcgccgatcgcggcacgctgggcggtgtcaatgccgcccctgactcgtcctccgac
gtggccctgtccctgccggccctgccgcaggacggtgcggaatacatcgtgacgctggcc
gccatcgccaagaacgacagcatccgcggcgtgccggcgcattcgacggtcggctggagc
cagtttgtgctgcgcccggcttcggccgcggcggaggctacggccttcgtcaaaccacag
caggagggcaaggccatcaccctcagcgccgccgggcgcacgctgagcatcgacgccgat
acgggcctgatcgcgctggacagcgacggcaagaccctgctcaaaggcggcacacccaac
ttctggcgcggcctgaccgacaatgacgaaggtgccaatgtggcgcgtaaccacggcatc
tggaaaagcctgaccgaaaaccgccgcgtgcgcgacctgaaggtcgaggctgaccgcgta
caggtgctgttcgtgcacggccccggtcaggtgaaggtcaccgtcacctaccgcctgcgc
accaacggcaaggtcatggtcaccaccgacttcgacccaatcaaggatgatctgcccgat
ccgctgcgcgttggtctgcgctttgacaccgatccgtctctggccaatctcgaatggtac
ggacgcggaccgcaggaatcgtacgttgatcgtcagaccggttacgccatcggtcgttat
aagggcacggtggccgagcagttccacgactatgcccgcccgcaggaaacgggcaacaag
accgaggtgcgctggatcgccgtctccgatgcttcaggtaagggcgtgaaggtgaccggg
gcccagcccctgagcgccaatgccctcgccttcccctatgaagacctctatgcccgcccg
cgcggggaatggcgtgccgctgacgtcacgccgcgtggtgacgggacgctgctgatcgac
ctggcccagatcggtgtcggcggcgataccggatggtcgcaggaggcgcgctcgctggtc
aagtaccgcatcccgctgaagccccagacctacagcttcaccatcgagacgacggtgcct
taa

DBGET integrated database retrieval system