KEGG   Asticcacaulis excentricus: Astex_1269Help
Entry
Astex_1269        CDS       T01378                                 

Definition
protein-l-isoaspartate o-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aex  Asticcacaulis excentricus
Brite
Enzymes [BR:aex01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Astex_1269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1342453..1343103
Genome map
AA seq 216 aa AA seqDB search
MSEAPLPETRIERLLASLKAQGIQDEKLLHAMEYTPRDLFVPELFLDRSWEDSAIPIAAG
QTISQPYIVALMTQALKLEGRHRVLEIGTGSGYQTAILSRLCRYVYTIERYRSLMLEAEI
RHKRLMMENIIYRFADGWDGWPEQAPFDRILVTAALPDEPLPLLAQLKVKGIMVAPQGRG
SVQRLLRYTRTPEAYEVEDLGEVRFVPLIEGVAKDA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcccctctgccggaaacccgcattgagcgcctgctggccagtctgaaagcg
caaggcattcaggacgaaaagctgctgcacgctatggaatatactccgcgcgacctgttc
gtgccggaattgttccttgaccgttcgtgggaggattctgccatccctatcgcggcgggg
cagaccatttcgcagccctatatcgtcgccctgatgacgcaggccctgaagctggaaggc
cgccatcgggtgctggagatcggcacggggtccggctatcagacggcgatcctgtcgcgc
ctgtgccgctacgtctatactatcgagcgctatcgctccctgatgctggaggctgaaatc
cgccataagcgactgatgatggagaacattatctatcgctttgccgatggctgggacggt
tggccggagcaggcgccgtttgaccgtatccttgttaccgcggcgcttcccgacgaaccc
ctgccgcttttggcacagctcaaagtcaaggggatcatggtcgcgccgcaggggcgtggc
tcggtgcagcgcctgctgcgttatacgcgcacccccgaagcctatgaggtcgaagatctc
ggcgaggtgcgctttgtgccgctgattgaaggcgtggccaaggacgcttaa

DBGET integrated database retrieval system