KEGG   Asticcacaulis excentricus: Astex_1320Help
Entry
Astex_1320        CDS       T01378                                 

Definition
pfkb domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aex  Asticcacaulis excentricus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Astex_1320
Enzymes [BR:aex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Astex_1320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1414655..1415575)
Genome map
AA seq 306 aa AA seqDB search
MSASILVLGSINVDFFIRVDALPKPNETIIGHDTAVAMGGKGLNQAVAAAQAGVTTRMVG
AVGDDNFGGMARDFLKKRGVDEASVVVLDGVGTGMANILVAPDGQNMIVVSSAANASLTP
AHAEAAEALIASAGAMVVQLETPLDTLKTALEIATANGVKTVLNPAPVDNGVFDLLPLCE
VVTPNETELAKLTGIDGQDDESLIRAMQTLRAHGAETVITTLGANGCAGLIDGELVRLPA
FKVEAVDAVGAGDVFNGALAARLVLGDDYVSAMRYASAASAISVTRRSADAAPTAAEVDA
FLRERT
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcctccattctcgtcctcggctcgattaatgtggacttctttatccgggtcgat
gccctgcctaaaccaaatgagacgatcataggccacgacacggcggtggccatgggcggc
aaggggctcaatcaggcggtggcggcggcgcaggccggtgtcaccacccgcatggtcggc
gcggtgggtgatgacaatttcggcggcatggcgcgcgattttctcaaaaagcgtggcgtc
gatgaggcgtctgtggtggtgctggacggtgtcggcaccggcatggcgaatattcttgtc
gcgcccgatggtcagaacatgatcgtcgtttcctcagcggccaatgccagcctgacgccc
gcccatgccgaagccgccgaagcgctgattgcctcggccggggcgatggttgtgcagctt
gaaacgccgctcgacacactgaaaaccgcgctggaaatcgccacggcaaacggcgtgaag
accgttctcaaccccgccccggtcgataacggcgtcttcgacctcctacccctgtgcgaa
gtggtgacgcccaatgagacggaactggccaaactgaccggcatagacgggcaggacgat
gagtcgctgatccgcgccatgcagaccctacgcgcgcatggggctgaaaccgtcatcacg
acgctgggggccaatggctgtgccggtctgatcgacggtgaactggtgcgcctgcccgcc
tttaaggttgaagccgtggatgcggtgggcgcaggtgacgtgttcaatggcgcactggcc
gcacggctggtccttggcgacgactacgtgtcggccatgcgctatgcctcagcagcctca
gccatttcggtcacgcgccgctcggccgatgccgccccgacagcggcggaggtagacgcg
tttctgcgtgagcgtacgtag

DBGET integrated database retrieval system