KEGG   Asticcacaulis excentricus: Astex_1595Help
Entry
Astex_1595        CDS       T01378                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
aex  Asticcacaulis excentricus
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:aex00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1720097..1721440)
Genome map
AA seq 447 aa AA seqDB search
MTRIASLSTAAPLMAIPEYRPPEGGVGEWFRGAGGLRLRLGFWHPKGPARGTVFVSPGRA
EPIEKYYEVVTDLLERRFCVVVHDWRGQGLSARLLPDRLKGHARSEDEFLDDYQRLLDGF
EDRAPKPWVMLGHSMGAALNLATLTRGEERFSAAVFINPMLRIKTGKHSLWSVMFQTDWK
VKHGQASEYVPELFDDPFEHTFEEDALTHDAARYNLWREQLFACPHLAVGTPTWGWLLFA
LRIGDTLLKDKGKVLKKVRTPVSVVISSDDSLMMKQPTKAFVKKLAKGRCVEIAGADHEI
LMEMDAYRRAFWAEFDEQVSFNLPSEALPSASVISSVAEVPVAEVTVSEPVLPAATEVFD
SHVPAEAVEAVVVAEPVETEVRPATAQPIFFSYELNDIPVYAPQPPPERLSVPEGLRAQR
DEVEVADWEEAPTEAAEETPADVSAKP
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgacacgcattgcttccctgtccaccgcggccccgctgatggcgataccggaataccgg
ccgcccgaagggggcgtgggtgaatggttccgcggtgcgggggggctgcgtctgcggctg
ggcttctggcatccgaagggaccggcgcgcggcacggtcttcgtcagccccggccgggcc
gagccgattgaaaaatattatgaggtcgtcactgaccttctggagcggcggttttgtgtg
gtcgtgcacgactggcgcgggcaggggttatcggcgcgtttgctgcccgaccgtctgaaa
ggtcatgcgcgctccgaagacgaatttctcgacgattatcaacgcctgctggatggcttt
gaggaccgcgcgcccaagccgtgggtgatgctgggccattctatgggggcggcgctcaat
ctggcgaccctgacgcgtggtgaggagcggttcagcgcggccgtcttcatcaatccgatg
ctgcgcatcaagacgggcaagcactccctgtggtcggtgatgttccagaccgactggaag
gtcaaacacggtcaggccagcgaatatgtgccggaactgtttgacgatccgtttgagcac
accttcgaagaagacgccctgacccacgatgcagcgcgctataatctgtggcgcgagcaa
ctgtttgcctgcccgcatctggcggtggggacgccgacctggggctggcttttgtttgcg
ctgcgcatcggcgataccctgctcaaggataagggcaaggtgctgaaaaaggtgcgcacg
ccggtgtcggtggtgatctccagcgacgatagcctgatgatgaagcagccgaccaaggcc
ttcgtcaagaaactggccaaggggcgttgcgtcgaaatcgcgggcgctgatcatgaaatc
ctgatggagatggacgcgtatcgccgcgccttctgggccgaatttgatgagcaggtcagc
ttcaacctgccctccgaggctctaccgagcgcgtctgttatttcatctgtggcagaggtc
ccggtggccgaagttacggtgagcgaaccggtcctgcccgccgctaccgaggtgttcgat
tcgcacgtccccgctgaggcagtggaggcggtggttgtcgcggagcccgtggagacggaa
gtgcgtccggcaacggcacagcctatctttttttcctatgaactgaatgacattcccgtc
tatgcgccgcaaccgccgccggaacgtctatcggtgccggaaggcctgcgcgcgcagcgg
gatgaggtcgaggtcgcggactgggaagaggccccaacggaggccgccgaagagactccg
gctgacgttagcgccaaaccgtaa

DBGET integrated database retrieval system