KEGG   Asticcacaulis excentricus: Astex_1685Help
Entry
Astex_1685        CDS       T01378                                 

Definition
holliday junction DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
aex  Asticcacaulis excentricus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aex00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Astex_1685
Enzymes [BR:aex01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Astex_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1819148..1819765)
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGILLEIEDDEAVIEVMGLGYIVKCGVRTLANLPANGQEAILHIESQTREDGTRL
YGFLSKDERKTFQQLLTVQGVGPKAALSVLDILTPHELAIAVAHEDKTKVNKANGVGPKL
AQRIVIELKGKALAIGEAFVPVAPGVVLASASSAASRSGESVAALMGLGIPEAQSRQAVE
AAVKELGPEAELAAVIRASLKLIGK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggcggctacgcggtattctgctggaaatcgaagacgatgaagccgtgatcgag
gtcatgggccttggctacatcgtcaaatgcggggtgcgcaccttagccaacctgcctgcg
aatggtcaggaagcgattctgcacatcgagagccagacgcgcgaagatggcacacggctt
tatggctttttgtcgaaggacgagcgcaagacatttcagcaattgctgaccgtacaggga
gtagggcccaaggcggcactatcggtgctcgacatcctgacgccgcacgaactggctatt
gctgtagcccatgaggacaaaacgaaggtcaacaaggccaacggagtggggcctaagctg
gcccagcgcatcgttatcgagctgaagggcaaagcgctggcgatcggggaggccttcgtg
cctgtggcccccggtgtggtgttagcctcggcgagctcggcggccagccgcagtggcgag
agtgtggcggccctgatggggctgggcattcccgaagcgcagtcgcggcaggcagtcgaa
gcagcggtcaaggagttggggcccgaagccgagttggcggcggtgatccgggcatctctg
aaattgattggcaagtaa

DBGET integrated database retrieval system