KEGG   Asticcacaulis excentricus: Astex_1685Help
Entry
Astex_1685        CDS       T01378                                 

Definition
holliday junction DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
aex  Asticcacaulis excentricus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:aex03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1819148..1819765)
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGILLEIEDDEAVIEVMGLGYIVKCGVRTLANLPANGQEAILHIESQTREDGTRL
YGFLSKDERKTFQQLLTVQGVGPKAALSVLDILTPHELAIAVAHEDKTKVNKANGVGPKL
AQRIVIELKGKALAIGEAFVPVAPGVVLASASSAASRSGESVAALMGLGIPEAQSRQAVE
AAVKELGPEAELAAVIRASLKLIGK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggcggctacgcggtattctgctggaaatcgaagacgatgaagccgtgatcgag
gtcatgggccttggctacatcgtcaaatgcggggtgcgcaccttagccaacctgcctgcg
aatggtcaggaagcgattctgcacatcgagagccagacgcgcgaagatggcacacggctt
tatggctttttgtcgaaggacgagcgcaagacatttcagcaattgctgaccgtacaggga
gtagggcccaaggcggcactatcggtgctcgacatcctgacgccgcacgaactggctatt
gctgtagcccatgaggacaaaacgaaggtcaacaaggccaacggagtggggcctaagctg
gcccagcgcatcgttatcgagctgaagggcaaagcgctggcgatcggggaggccttcgtg
cctgtggcccccggtgtggtgttagcctcggcgagctcggcggccagccgcagtggcgag
agtgtggcggccctgatggggctgggcattcccgaagcgcagtcgcggcaggcagtcgaa
gcagcggtcaaggagttggggcccgaagccgagttggcggcggtgatccgggcatctctg
aaattgattggcaagtaa

DBGET integrated database retrieval system