KEGG   Asticcacaulis excentricus: Astex_1733Help
Entry
Astex_1733        CDS       T01378                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
aex  Asticcacaulis excentricus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Astex_1733
   00670 One carbon pool by folate
    Astex_1733
Enzymes [BR:aex01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Astex_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1868255..1868776
Genome map
AA seq 173 aa AA seqDB search
MQKPKLALIVAMSENRVIGRDNALPWHLKSDLKLFKAATQFKPIIMGSNTWDSLPRKPLP
GRLNLVCSRDLKFEAEGGIVCNSLFEALDIAREHAADDGADEVVVIGGANIYEQTLPKAD
RLYVTEVHTTLDGDARFPEIDPAQWVEVKSEFCPKAEGDDYDFTVKVYERKRI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaacccaaactcgcccttatcgtcgccatgagcgagaaccgcgtcatcgggcgc
gacaacgcccttccgtggcatctgaaatccgacctgaagctgttcaaggccgccacccag
ttcaaacccattatcatggggtcgaacacctgggactccctgccgcgcaaaccgctgccg
gggcggctgaaccttgtctgctcgcgtgatctgaagttcgaggccgagggcggcatcgtc
tgtaattcactgtttgaagcgcttgatatcgcccgtgaacacgccgctgatgacggagcg
gatgaggtggtcgtgatcggcggagccaacatctatgaacagactctgcccaaagccgat
cgcctctatgtgaccgaggtgcacacaacgctggacggcgatgcgcgttttccggagatc
gacccggctcaatgggtcgaggtgaagtcggaattttgccccaaggcggagggcgacgat
tacgacttcactgtgaaggtctatgagcgcaaacgcatataa

DBGET integrated database retrieval system