KEGG   Asticcacaulis excentricus: Astex_1741Help
Entry
Astex_1741        CDS       T01378                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
aex  Asticcacaulis excentricus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aex00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aex00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1876366..1877517
Genome map
AA seq 383 aa AA seqDB search
MTLRNSSALAALVLTLMGVNTAQAATATSETFGKLSDGTEVKAVVLKNAKGVSAKVITYG
ATLQSLWAPDRQGKAAEITIGYDDLKGYVETPQYLGVTVGRFANRIAKGKFTLDGKTYTL
ATNNNGNHLHGGLKGFDKVNWTLAAVKSGGKTGEASATFTYTSPDGEEGYPGTMKIEVTY
SLTENNDLTIRYKATTDKPTIVNLTNHALFNLAGVGSGRSALEASLQLESDGYLPTNETA
IPYGNIAPVKGTPFDFTKPAVINERVRDARDPQILIGLGIDHNYVLRGGVTKTPKQAVTL
IDAKSGRGLKILTTEPGIQMYTGNFLDGKVPGRNGQVTRMGDAVAFEAQHFPDSPNQPQF
PTTRLNPGETYTQTTVHHLFVAK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgactctccgcaattcgtctgcgctcgcagcgcttgttctaacgctgatgggcgttaat
accgctcaagccgccaccgccaccagcgaaaccttcggaaagctgtccgacggcaccgag
gtcaaggccgtggtgctgaaaaacgccaaaggtgtttcggccaaggtcatcacctatggc
gcaaccctgcaatcgctgtgggctcccgatcgtcaaggcaaggccgccgaaatcaccatc
ggctatgacgacctgaagggctatgtcgaaaccccgcaatatctgggtgtgaccgttggt
cgcttcgccaaccgcatcgccaagggcaagttcacgctggatggcaagacctatacactg
gccaccaacaataatggcaaccacctgcacggtggcctgaaaggctttgacaaggtcaac
tggaccctggctgcggtcaaaagcggtggcaagacgggcgaggcttcggccaccttcacc
tatacctcaccggatggcgaggaaggctatcctggcaccatgaagattgaggtgacctat
agcctcactgaaaacaacgacctgaccattcgctataaggcgacgacggacaagccgacc
atcgtcaacctgaccaaccacgccctgttcaatttggcaggcgtggggtcgggccgctcg
gccctcgaagcctcgctgcaactggaatccgacggttatctgcccacaaatgaaaccgcc
attccatacggcaatatcgccccggtcaagggaacgccgtttgatttcaccaagccggcg
gtgatcaatgaacgcgtgcgcgacgcccgcgatccgcaaatcctgattggcctcggcatc
gaccataactacgtcctgcgcggcggcgtgaccaagacgcctaaacaggccgtcaccctg
attgatgctaaatcgggccgcggcctgaagatcctgaccaccgagccaggcattcagatg
tacaccggcaacttcctcgacgggaaggttccgggccgcaacggtcaggtcacgcgcatg
ggcgacgccgtcgccttcgaagcccagcacttccccgatagccctaaccagccgcagttt
ccgaccactcgtctgaaccccggcgaaacctatacccagacgacggttcaccacctcttc
gtcgctaagtaa

DBGET integrated database retrieval system