KEGG   Asticcacaulis excentricus: Astex_1746Help
Entry
Astex_1746        CDS       T01378                                 

Definition
alcohol dehydrogenase groes domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aex  Asticcacaulis excentricus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Astex_1746
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Astex_1746
  Lipid metabolism
   00071 Fatty acid degradation
    Astex_1746
  Amino acid metabolism
   00350 Tyrosine metabolism
    Astex_1746
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Astex_1746
   00626 Naphthalene degradation
    Astex_1746
Enzymes [BR:aex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Astex_1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1883396..1884430
Genome map
AA seq 344 aa AA seqDB search
MAKTMKAAVVRQFGKPLTIDEVPMPEPGEGLIQVAIQASGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGYVSAVGKGVKHVKEGDRVGVPWLYTACGHCRHCLGGWETLCESQLNTGYSV
NGGFAEYVVADPNFVGHLPKNISFTEIAPVLCAGVTVYKGLKVTDTKPGDWVVISGVGGL
GHMAVQYAKAMGLNVAAVDIDDAKLDLALRLGATVTVNAKTEADPAAFIKKATDGGAQGV
LVTAVSTTAFKQALGMVSRGGTVSLNGLPPGEFPLDIFGMVLNGVTVRGSIVGTRLDLQE
SLDFASDGKVKATIATEKLENINDIFARMHKGQIEGRIVLDMAD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaccatgaaggcggccgtcgtccgtcagttcggaaaacccctcaccatcgac
gaggtgccgatgccggaaccgggcgaaggcttgattcaggtggccattcaggcgtctggc
gtctgtcacaccgaccttcacgccgccgaaggcgactggccggtgaagcccaatcccccc
ttcatccccggtcacgaaggcgtcggttacgtttcggcggtgggcaagggcgtgaagcac
gtcaaggaaggcgaccgcgtcggcgtgccatggctgtatacggcctgtggccattgccgt
cactgtctgggtggatgggaaaccctatgcgaatcccagctcaacaccggctactcggtc
aatggcggctttgccgaatatgtggtggccgatccgaacttcgtcggtcacctgcccaaa
aacatcagctttacggaaatagcaccggtcctgtgcgcaggcgtgaccgtctataagggg
ctgaaggtcaccgacaccaagcccggcgactgggtggtcatttccggcgtcggtggtctg
ggccacatggccgtgcaatatgccaaggccatgggcctgaacgtcgccgccgtcgatatt
gacgacgccaagctcgacctcgccctccgtctgggcgcgaccgtgacggtcaatgccaaa
acggaagccgacccggcggcctttattaagaaggccaccgatggcggcgctcaaggcgtt
ctcgttacagcggtttcgaccaccgccttcaagcaggcgctcggcatggtgtcgcgcggc
ggcacggtgtccctgaacggtctgccaccgggggaattcccgctcgacatcttcggtatg
gtgctcaatggcgtgactgtacgcggctccatcgtcggcacgcgcctcgaccttcaggaa
tcgctagattttgccagcgacggcaaggtcaaggcgaccatcgccaccgaaaagctggaa
aacatcaatgacatctttgcgcgtatgcacaagggacagatcgaaggccgcatcgtgctc
gacatggccgactga

DBGET integrated database retrieval system