KEGG   Asticcacaulis excentricus: Astex_1764Help
Entry
Astex_1764        CDS       T01378                                 

Definition
gtp cyclohydrolase i (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aex  Asticcacaulis excentricus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Astex_1764
Enzymes [BR:aex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Astex_1764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1901662..1902330
Genome map
AA seq 222 aa AA seqDB search
MDSLDPNSRPHSEDPLTQALAQTRSKGFSEILNVERPSKEEAMAAVRTLLAWAGDDPTRE
GLIDTPKRVVEAYDEWFSGYQADPAKELSRTFEDVQGYDDMVMLRHIDVESHCEHHMASF
LGKAYVAYMPTAKVVGISKIARVVEIFSKRLQTQETLTKQIADAIEQSLAPLGVAVLIDA
EHQCMTTRGVHHKNVTTVTTRFTGVFKADLALQDRFMRFCQA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggacagcctcgacccgaattcccgcccgcacagcgaagacccgctgactcaagcactc
gctcaaacgcgtagcaagggctttagcgaaatcctcaatgtcgagcgtccgtcgaaggaa
gaggctatggccgccgtgcgcacgcttctggcttgggccggcgacgatcccacgcgcgaa
ggcctgatcgacacgcccaagcgcgtcgtcgaagcctatgacgagtggttctccggctat
caggccgatccagccaaggaactgtcgcgcacctttgaagacgtgcagggctatgatgac
atggtcatgttgcgccatatcgacgtcgaatcgcactgcgaacaccacatggcgtccttc
ctcgggaaggcctacgtagcctacatgccgaccgccaaggtggtaggtatctccaagatc
gcgcgagttgtcgaaattttctccaagcgcctgcaaacgcaggaaaccctgaccaagcag
atcgccgacgccatagagcagtcgcttgccccgcttggcgtcgccgtactgatcgacgcc
gagcatcaatgcatgacgactcgcggcgtccaccacaagaacgtcaccacggtcaccacc
cgctttaccggcgtgttcaaggccgacctggcgcttcaagaccgttttatgcgcttctgt
caggcctga

DBGET integrated database retrieval system