KEGG   Asticcacaulis excentricus: Astex_1927Help
Entry
Astex_1927        CDS       T01378                                 

Definition
(RefSeq) malate synthase g (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
aex  Asticcacaulis excentricus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Astex_1927
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Astex_1927
   00630 Glyoxylate and dicarboxylate metabolism
    Astex_1927
Enzymes [BR:aex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Astex_1927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2061414..2063528)
Genome map
AA seq 704 aa AA seqDB search
MAYTPVSGIEVDDILWRFVREEALPGSGVAEAAFWDGLAGLIRDFGPRNAALLAKRDALQ
TQIDNWHRSHAFEPVAYKAFLSEIGYLRPEPAAFTVTTADVDEEIACLSGPQLVVPVSNA
RYALNAANARWGSLYDALYGTDVLGLVPAPGGYDATRGAAVQAAAKAYLDEFVPLDDLSH
AEVSAYAVVDGQLRANGAPLKDPSQFVGFSGPPDAPQSILLRHNGLHIDIRIDRHSPVAD
AAGVADVVLEAALSAIMDMEDSVAAVDAADKVGLYRNWLGLTRGDLSEQFHKGGQVHTRR
LNPDRTYKAPDGQAFALHGRSLMLARNVGLHMYSDMVRHKGQAVPEGLIDLMITALIAHH
DAGRNSRTGSAYIVKPKMHGPDEVGFAVETFAFTERAVGLPERTLKIGIMDEERRTSVNL
RACIAAAKDRVFFINTGFLDRTGDEIHTSMEAGPVLRKGEIKGAIWIKAYEDSNVDCGLI
AGLPGHAQIGKGMWAAPDMMADMMTQKIGHLNAGASTAWVPSPTAATLHALHYHRVDVAA
VQAQLRVRPRALVDDILTPPLATRTYNPEEIAEELDNNLQGILGYVVRWVDQGVGCSKVP
DIHDVGLMEDRATLRISSQHVANWLRHGWVSEAQVLERLKHMAMVVDAQNAGDAAYRPMA
PDYVGEAFKAACDLCFDGARQPNGYTEFILHARRQAAKRVVERA
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggcctacacccccgtctccggtatcgaggttgatgacatcctgtggcgctttgtccgc
gaagaggccctgccgggctctggcgtggccgaggcggcgttttgggacgggctggcgggg
cttatccgcgactttggcccgcgcaatgccgcccttctggcgaagcgcgacgccttgcag
acacaaatcgacaactggcaccgcagccacgcctttgagccggtggcctataaggccttt
ttgagcgagatcggttatctgcggcccgaaccggcggcgttcaccgtcacgacggcggat
gtcgatgaggagattgcgtgcctgagcgggccgcaactggtcgtgccggtgtccaatgcc
cgctatgcgctgaacgccgccaatgcccgttggggcagcctttacgacgccctctatggc
acggatgtgctggggctggttccagcgccgggcggctatgacgccacgcgcggtgccgcg
gtgcaggctgcggccaaggcctatctcgatgaattcgtgccgctggacgacttaagccac
gccgaggtctcggcctatgcggtggtggacggacagttgcgggccaatggcgcgccgctg
aaagacccgtcacagttcgtcggtttcagcggcccgcccgacgcgccacagtcgatcctg
ttgcgccacaatggcctgcatatcgatatccgtattgaccgccacagcccggtggccgat
gcggccggcgtcgccgacgtcgtgctcgaagcggccttgtccgccattatggacatggaa
gacagcgtcgctgccgtcgatgccgcggacaaggtcggcctctatcgcaactggctgggc
ctgacgcgtggcgacctcagcgagcagttccacaaaggcggtcaggtgcacacgcgccgc
ctcaatcccgaccgcacctacaaggcccccgacggtcaggccttcgccctgcatgggcgt
agtctcatgctggcgcgcaatgtcggcctgcatatgtacagcgatatggtgcgccataaa
ggtcaggccgtgccggagggtttgatcgacctaatgatcaccgccctcatcgcgcaccac
gacgccggccgcaatagccgcacgggctcagcctatatcgtcaagccgaagatgcacggg
ccggacgaggtgggttttgcggtggaaaccttcgccttcaccgagcgcgccgtgggcctg
cccgaacgcactctgaagatcggcatcatggacgaagagcgccgtaccagcgtcaatctc
agggcctgtatcgccgccgccaaggaccgcgttttcttcatcaatacgggcttccttgac
cgcacgggcgatgaaatccatacctcgatggaggccggtccggtcctgcgcaagggcgag
atcaagggggccatctggatcaaggcctatgaggactccaatgtcgattgcgggctgatc
gccggtctgcccggccatgcccagatcggtaagggcatgtgggcggcgccggatatgatg
gcggatatgatgacccaaaagatcggccatctgaacgccggggcctcgaccgcctgggtg
ccgtcacccactgcggccaccctgcacgccctgcactatcaccgagtcgatgtggccgcc
gttcaggcgcagttgcgagtgcggccgcgcgccttggttgatgatatcctgacgccgcca
ctggcgacgcgaacctataaccccgaagagattgctgaagaactggacaataatttgcag
ggcattctcggctacgtggtgcgctgggttgatcagggcgtgggctgttccaaggtgccg
gatatccatgatgtcggcttgatggaagaccgcgccaccttgcgcatctccagccagcac
gtggccaactggctgcggcacggctgggtgtccgaggcgcaggtcttggagcgcctgaaa
cacatggccatggtcgtcgatgcgcaaaatgcgggtgatgcggcctatcgcccgatggcg
ccggactatgtcggcgaggcgttcaaggccgcctgcgacctgtgctttgacggagccaga
cagcccaatggctatacggagttcatcctgcacgcccggcgacaagcggcgaaacgtgtg
gtggaacgagcatag

DBGET integrated database retrieval system