KEGG   Asticcacaulis excentricus: Astex_1971Help
Entry
Astex_1971        CDS       T01378                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
aex  Asticcacaulis excentricus
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:aex00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:aex00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2117161..2117943
Genome map
AA seq 260 aa AA seqDB search
MLTGKTALVTGSTSGIGLAIARKLASKGAKVMLNGMGDAAEIEKLRAEMAAEFGVEVAFN
SADLTKVEGIEALIADTTQKLGDLDILVNNAGIQHVSPIEDFPVDKWNMIIALNLSAAFH
TTRLSFKGMKDRGWGRIINIASAHALVASPFKAAYVAAKHGIAGLTKTIALEGAEHGVTC
NAICPGYVLTPLVEKQIPDTAKARGLTEEQVIKDVLLAAQPSKKFVETDDIAELVVFLSS
DAAKAITGALQSIDGGWTAA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctgactggcaaaaccgccctcgtaaccggctcgacgtcgggtatcggactggccatc
gcgcgaaagttggcctcaaagggcgcaaaggtgatgctgaacggtatgggggatgccgcc
gaaatcgaaaagctgcgcgccgaaatggcggccgaattcggcgtcgaggtggcctttaat
agcgcagacctgaccaaggtcgaaggcatcgaggctctgatcgcggacacgacgcaaaag
ctgggggacctggacattctggtcaacaatgccggcattcagcacgtctcccccatcgaa
gacttcccagtcgacaagtggaacatgatcatcgcgctgaacctgtcggcggcattccac
accacgcgcctaagttttaagggcatgaaagatcgcggctggggccggatcatcaacatc
gcctcggcgcacgccctcgtcgcctcgccattcaaggcggcctatgtggcggccaagcat
ggcattgccggcttgaccaaaacgattgccctcgaaggggctgaacacggcgtgacctgc
aacgccatctgccccgggtacgtactgacgccgctggtcgaaaagcagatcccggatacc
gcaaaggcgcgcggacttacagaggaacaggtgatcaaggacgtgctgctggcggcccag
ccgtccaaaaagtttgtcgaaaccgatgacatcgccgaacttgtcgtcttcctgtcttcg
gacgccgccaaggcaatcaccggcgcgttgcaatccatcgacggtggctggacggcagca
tag

DBGET integrated database retrieval system