KEGG   Asticcacaulis excentricus: Astex_2310Help
Entry
Astex_2310        CDS       T01378                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00010  Glycolysis / Gluconeogenesis
aex00030  Pentose phosphate pathway
aex00051  Fructose and mannose metabolism
aex00052  Galactose metabolism
aex00230  Purine metabolism
aex00500  Starch and sucrose metabolism
aex00520  Amino sugar and nucleotide sugar metabolism
aex00521  Streptomycin biosynthesis
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01120  Microbial metabolism in diverse environments
aex01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Astex_2310
   00030 Pentose phosphate pathway
    Astex_2310
   00051 Fructose and mannose metabolism
    Astex_2310
   00052 Galactose metabolism
    Astex_2310
   00500 Starch and sucrose metabolism
    Astex_2310
   00520 Amino sugar and nucleotide sugar metabolism
    Astex_2310
  Nucleotide metabolism
   00230 Purine metabolism
    Astex_2310
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Astex_2310
Enzymes [BR:aex01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Astex_2310
    5.4.2.8  phosphomannomutase
     Astex_2310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADU13964
JGI: Astex_2310
UniProt: E8RMT3
Position
1:complement(2506103..2507608)
Genome map
AA seq 501 aa AA seqDB search
MTLLLPRTDLVENTFEFETEAFVKTTGFREYDARWVFGKEINLLGIQALGLGLGTYIHER
GVKPRIVVGHDYRSYSINIKNALILGLIQAGCEVLDIGLCLSPIAYFAQFDLEAPCVAMV
TASHNENGWTGVKMGCQAPLTFGPDEIGRMKEIIMAGAAVERAGGSLKLVSGVQERYLAD
VAAKAQLKRKLKVICACGNGTAGAFAPQALRAMGAEVIEMDTLLDSTFPKYNPNPEDHHM
LMEMAKAVKEHGADLALGFDGDGDRCGVVDDTGEEIFADKIGLMLARDLSAIHKDATFVV
DVKSTGLYKTDEILKANGAQTVYWKTGHSYIKRKTSELKALAGFEKSGHFFFNSPIGLGY
DDGLVAAAAVLAMLDRNPGKALSELKNALPVAYTSLTMSPHCGDEVKYQVLEKVVQEYVD
LHAKGGEILGRKIVEVITVNGARVHLEDGSWVLVRASSNKPELVVVVESLNSADDMRDLF
RKEVKPRLAAHPEVGAYNQEI
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgcttttaccgcgcacggacctcgttgagaacacgtttgaattcgagacagag
gccttcgttaagacgaccggatttcgcgagtacgacgcgcgctgggtgtttgggaaggaa
atcaatcttttaggcattcaggcgctcggcctcggtcttggcacctatattcacgaacgt
ggggtcaagccacgcatcgttgtgggtcatgactatcgctcttactcgatcaatatcaaa
aatgcgctcatcctcggtctgatccaggcgggatgtgaggtgctggatattggcctgtgc
ctctcaccgattgcctattttgctcagttcgaccttgaagcgccctgcgtcgccatggtc
accgcgtcgcacaatgaaaacggctggacgggcgtgaagatggggtgccaggcccctctg
accttcggtcctgacgaaatcggccgtatgaaagagatcatcatggccggtgccgctgtc
gagcgggcgggtggttcgctcaagctcgtttcgggtgtccaagagcgttatctggccgat
gtcgccgccaaggcgcaattgaagcgtaagctgaaggtcatctgcgcttgcggcaacggt
acggccggcgcttttgcccctcaggccctgcgtgccatgggcgctgaggtcattgaaatg
gacaccttgcttgacagcacgttcccgaagtataaccccaaccccgaagatcatcacatg
ctgatggagatggccaaggccgttaaagagcatggagcggatctggctctgggctttgac
ggtgacggtgaccgctgcggtgttgtcgatgacacgggcgaagagatttttgcggacaag
atcgggcttatgctggctcgcgatctctccgctattcacaaagacgcgaccttcgttgtc
gatgtgaagtcaaccggcctctacaagacggacgaaattctgaaagccaatggggcccaa
accgtctactggaagacggggcactcctacatcaagcgcaagacttccgagctgaaggcg
ctggccggtttcgaaaagtctggccatttcttcttcaatagcccgatcggtcttggctat
gacgatggcctagtagcggcggcggcggtactggctatgctcgatcgcaatccgggtaag
gccttaagtgaactgaaaaacgctttgccggtggcctatacctcattgaccatgtcgcct
cactgtggggatgaggtcaaatatcaggtcctcgaaaaagtcgtacaggaatacgtcgac
ttgcatgccaagggcggcgagatcctcggtcgcaagattgtcgaggtgatcacggtcaac
ggggcacgtgtccatctggaggacggatcctgggttctggtgcgcgcctcgtccaacaag
ccggaactcgtcgttgtcgtcgagagcctgaattctgcggatgacatgcgcgatctgttc
cgcaaggaggtcaagcctcgtcttgccgcgcatcctgaagttggcgcctataatcaggaa
atctga

DBGET integrated database retrieval system