KEGG   Asticcacaulis excentricus: Astex_2311Help
Entry
Astex_2311        CDS       T01378                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aex  Asticcacaulis excentricus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Astex_2311
   00052 Galactose metabolism
    Astex_2311
   00500 Starch and sucrose metabolism
    Astex_2311
   00520 Amino sugar and nucleotide sugar metabolism
    Astex_2311
Enzymes [BR:aex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Astex_2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2507639..2508514)
Genome map
AA seq 291 aa AA seqDB search
MTQKRVRKAIIPVAGLGTRVLPGTKVVPKELLNVVDRPILSYVVAEARASGIEHFVFVTG
RSKGAIEDYFDHQVELEAQLSAKNKTAILDELLAELPQAGEMSFVRQMQPKGLGHAVWCA
RDIIGDEPFAVILPDMVMDADVPALKQAIDGYDKVGGNIIVVEPVPVDQTHQYGVVALEA
QNGRLNKMTGMVEKPAKGTAPSNLIVSGRYILQPEIFELLATQEKGAGGEIQLTDSMFRL
METQDFHALEYDGVTYDCGDKIGLLRANVALALKRADLGQAAREALSPFFQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaaagcgcgtgcgcaaagccattattcccgttgcgggtctgggcacccgggtt
ctgccggggacaaaggtcgtcccgaaagagctcctgaacgtcgttgatcgtcccattttg
tcctatgtcgtggccgaggcccgcgcctcaggcattgagcatttcgtctttgtgacgggg
cgatccaaaggcgctatcgaagattatttcgaccatcaggtcgagctagaagcgcaactg
tcagccaagaacaaaaccgcaattctggacgaacttctcgcggaactgccgcaggctggc
gagatgagctttgtgcgtcaaatgcagcccaaggggcttggccacgcggtctggtgcgcg
cgcgacatcattggcgacgagcccttcgcggtgatcttgccggatatggtgatggacgca
gacgtgcccgcgctgaagcaggccattgacggctatgacaaggtgggcggcaacatcatc
gtggtagagcctgttcctgtggaccagacccatcagtatggcgtggttgcgctagaagcc
caaaacggccgcctgaataaaatgacgggcatggtagagaagccggcaaaaggcacggcg
ccctccaatctgattgtgtctgggcgctacattctccagcctgaaatcttcgagcttctc
gccactcaggaaaagggcgcagggggggaaatccagctcacggactccatgttccgtctg
atggagacccaagacttccacgcccttgagtacgacggcgtgacctatgactgcggcgat
aagattggccttcttcgtgccaatgttgccctggcattgaagcgcgcagaccttggccag
gccgcccgtgaagcgctcagcccgttttttcaataa

DBGET integrated database retrieval system