KEGG   Asticcacaulis excentricus: Astex_2324Help
Entry
Astex_2324        CDS       T01378                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
aex  Asticcacaulis excentricus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Astex_2324
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Astex_2324
Enzymes [BR:aex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Astex_2324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2521470..2522615)
Genome map
AA seq 381 aa AA seqDB search
MTVAAIKSDFPAHIAQAKRVTLKVGSALIVNPQTGAANTLWMRGLAEDVARLRKAGVEVM
IVSSGAGALGRRYLGLNTRQLPLDRKQAAAAAGQPILMRAWDEVFSEHGIKVAQVLLTRE
DTERRRRWLNARETADTLLKLGVVPIVNENDTVATEEIRYGDNDRLAARAAMLVRSEALV
LLSDIDGLYTADPRNNPSAEHIGVVETITPDIEAMAGGANAAAGVGTGGMATKIAAARIA
GAAGCSTTIMNGQGLRPLSALGQGARYTLFVAQASSGAAYKAWIAGTVVPAGQIHIDAGA
ANALALGKSLLPSGISSVAGVFDKGDSVSVLHDGRELARGIAAYSSDDIASIKGRASKEI
EALLGYTSGDEVIHRDDLVMV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcgcggctataaaatcggactttccggcgcatatcgcgcaggcgaagcgcgtg
accctgaaggtcggctcggccctgatcgtcaatccgcaaacgggcgcggccaacacgctg
tggatgcgcggtctggccgaggatgtggcgcgattgcgcaaggccggtgtggaggtgatg
atcgtctcctccggagcgggcgctctcggccggcgttatctggggcttaacacaaggcaa
ttgccgcttgatcgtaaacaggcggcggccgccgccgggcagccgatcctgatgcgtgcc
tgggacgaggtcttttctgaacatgggatcaaggtcgcgcaggttcttttgacgcgtgaa
gacaccgagcgccgccgtcgctggcttaatgcgcgcgaaacggcggacaccctgctcaag
ctgggcgtcgtgccgatcgtcaatgagaatgacaccgtggcgaccgaagaaatccgctat
ggcgacaatgaccggctggcggcgcgcgcggccatgctggtgcggtctgaggcactggtg
ctgctgtcggatattgacgggctctacaccgctgatccgcgtaacaatccgtcagcggaa
catatcggcgtggtcgaaaccatcacgccggatatcgaggccatggccgggggagccaat
gcggccgccggcgtcggcacaggcggcatggctaccaagattgccgcagcccgcatcgcc
ggtgcggcgggatgttcgaccaccatcatgaacggtcagggccttcggcctctttcggcg
ctggggcagggcgcacgctacaccctgtttgtggctcaggcttcgtcgggggcggcctat
aaggcgtggatcgccgggacggtggtgcctgcagggcaaatccatatcgatgccggggcc
gctaacgcgctggctttgggaaaatcgcttctaccttcgggcatcagctcggtcgcgggc
gtctttgataagggcgacagcgtatcggtcctgcacgacgggcgcgaactggcgcgtggt
atcgcggcctatagctccgatgatatcgccagcatcaaggggcgcgccagcaaagagatt
gaagctctcctgggctacacctcaggagatgaggtcattcaccgtgacgatctggtgatg
gtctga

DBGET integrated database retrieval system