KEGG   Asticcacaulis excentricus: Astex_2324Help
Entry
Astex_2324        CDS       T01378                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00330  Arginine and proline metabolism
aex00332  Carbapenem biosynthesis
aex01100  Metabolic pathways
aex01130  Biosynthesis of antibiotics
aex01230  Biosynthesis of amino acids
Module
aex_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Astex_2324
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Astex_2324
Enzymes [BR:aex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Astex_2324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA TruB_C Glyoxalase_4
Motif
Other DBs
NCBI-ProteinID: ADU13978
JGI: Astex_2324
UniProt: E8RN79
Position
1:complement(2521470..2522615)
Genome map
AA seq 381 aa AA seqDB search
MTVAAIKSDFPAHIAQAKRVTLKVGSALIVNPQTGAANTLWMRGLAEDVARLRKAGVEVM
IVSSGAGALGRRYLGLNTRQLPLDRKQAAAAAGQPILMRAWDEVFSEHGIKVAQVLLTRE
DTERRRRWLNARETADTLLKLGVVPIVNENDTVATEEIRYGDNDRLAARAAMLVRSEALV
LLSDIDGLYTADPRNNPSAEHIGVVETITPDIEAMAGGANAAAGVGTGGMATKIAAARIA
GAAGCSTTIMNGQGLRPLSALGQGARYTLFVAQASSGAAYKAWIAGTVVPAGQIHIDAGA
ANALALGKSLLPSGISSVAGVFDKGDSVSVLHDGRELARGIAAYSSDDIASIKGRASKEI
EALLGYTSGDEVIHRDDLVMV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcgcggctataaaatcggactttccggcgcatatcgcgcaggcgaagcgcgtg
accctgaaggtcggctcggccctgatcgtcaatccgcaaacgggcgcggccaacacgctg
tggatgcgcggtctggccgaggatgtggcgcgattgcgcaaggccggtgtggaggtgatg
atcgtctcctccggagcgggcgctctcggccggcgttatctggggcttaacacaaggcaa
ttgccgcttgatcgtaaacaggcggcggccgccgccgggcagccgatcctgatgcgtgcc
tgggacgaggtcttttctgaacatgggatcaaggtcgcgcaggttcttttgacgcgtgaa
gacaccgagcgccgccgtcgctggcttaatgcgcgcgaaacggcggacaccctgctcaag
ctgggcgtcgtgccgatcgtcaatgagaatgacaccgtggcgaccgaagaaatccgctat
ggcgacaatgaccggctggcggcgcgcgcggccatgctggtgcggtctgaggcactggtg
ctgctgtcggatattgacgggctctacaccgctgatccgcgtaacaatccgtcagcggaa
catatcggcgtggtcgaaaccatcacgccggatatcgaggccatggccgggggagccaat
gcggccgccggcgtcggcacaggcggcatggctaccaagattgccgcagcccgcatcgcc
ggtgcggcgggatgttcgaccaccatcatgaacggtcagggccttcggcctctttcggcg
ctggggcagggcgcacgctacaccctgtttgtggctcaggcttcgtcgggggcggcctat
aaggcgtggatcgccgggacggtggtgcctgcagggcaaatccatatcgatgccggggcc
gctaacgcgctggctttgggaaaatcgcttctaccttcgggcatcagctcggtcgcgggc
gtctttgataagggcgacagcgtatcggtcctgcacgacgggcgcgaactggcgcgtggt
atcgcggcctatagctccgatgatatcgccagcatcaaggggcgcgccagcaaagagatt
gaagctctcctgggctacacctcaggagatgaggtcattcaccgtgacgatctggtgatg
gtctga

DBGET integrated database retrieval system