KEGG   Asticcacaulis excentricus: Astex_2325Help
Entry
Astex_2325        CDS       T01378                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aex  Asticcacaulis excentricus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Astex_2325
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Astex_2325
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Astex_2325
Enzymes [BR:aex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Astex_2325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2522731..2524152
Genome map
AA seq 473 aa AA seqDB search
MLLRNGNKMNYIGTRGFKDQRSFAGALLDGLAPDGGLYVPQAWPTPDFDLSGVSKGGYAD
LTVKLLKLFGVDVLGDQAVKAAAQRTEDAFLRDGAVPLTRLEDDLYLLELYHGPTHAFKD
MAMQMMAPLTDAALSQRGEKLTLVTATSGDTGAAAVRAFAGSEHVKLIVFHPLGRVSPVQ
RLQMTTVQADNVLNVGVNGDFDDCQKIVKALLSEPSLKAQGLISSVNSINWGRLLGQVPY
YLAAAAHSGLNTPEFIVPTGNFGDAFAGWVARQIGGNVGHLHAAVNRNDALNQAINNGRY
VRRQAVETASVSMDVQAPSNFERLVFEASGRDADATRNLFDAFGQSGEVALSGNLQEALK
SEVSASSVSEDETKATIKLAYERWGQVICPHTAVALSAALTRREAGEGTGGQIVLATAHA
AKFPAFVTEALGFEPKAPDAITDLYGLTETLTEMPADITAAVTTVKAFIEWID
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcttttaagaaatggtaacaaaatgaactatatcggcacgcgcggtttcaaagatcaa
cgcagttttgcgggcgctctgctcgacggtctggcccccgacggcgggctttatgtaccg
caggcatggccgacaccggatttcgatctgtctggcgtgtcaaagggcggctatgccgac
ctgacggtaaaactactcaagctgtttggcgtggacgttctgggcgatcaggcggtcaag
gcggcagctcagcgcaccgaggacgcctttctgcgcgacggggccgtgccgctgacgcgg
ctggaagacgatctctatctgctcgagctctatcacggtccgacccacgccttcaaagac
atggccatgcagatgatggcgcccctgaccgatgccgccctttcacagcgcggcgaaaaa
ctgaccctggtgacggccacctccggcgataccggtgcagccgctgtgcgcgcctttgca
ggttctgaacacgtcaagctgatcgtttttcatccgctcggccgcgtctcacccgtacag
cgtcttcagatgacgacggttcaggccgataatgtgctcaatgtcggggtaaacggcgat
ttcgacgactgccagaagatcgtcaaggcgctgctgtctgagccttccttgaaagcacag
ggcctgatctcctcggtgaattcgatcaactggggccgcctgttggggcaggtcccctac
tatctggccgccgctgctcattcgggcctcaacacgccggaatttatcgtgccgaccggc
aatttcggtgacgccttcgccggatgggtggcgcgtcagatcggcgggaatgtcggtcac
ctgcacgctgccgtaaaccgcaacgatgcccttaatcaggccatcaataacggccgctat
gtgcgccgtcaggccgtcgagacggcctcggtctcaatggacgtgcaggcaccgtcaaac
tttgagcggctggtctttgaagcctccggccgtgacgcggacgcaacgcgcaacctgttc
gatgcctttggacagtccggtgaagtggcattgtccggtaatctgcaagaggccctgaaa
tctgaagtttcggcctcgagcgtctctgaagacgagaccaaggccaccatcaaactggcc
tatgagcgctggggtcaggtcatctgcccgcataccgccgtggcgctttcggcggccctg
actcgacgcgaagctggcgaaggcacgggcggacagatcgttttggccacagcgcacgcc
gccaagttcccggcctttgtgaccgaggcgctgggctttgagcccaaggccccggacgcc
atcaccgatctttatgggctgaccgaaaccctgaccgaaatgccagcagacatcaccgcg
gccgtcacgaccgttaaggcctttattgagtggatagattag

DBGET integrated database retrieval system