KEGG   Asticcacaulis excentricus: Astex_2359Help
Entry
Astex_2359        CDS       T01378                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aex  Asticcacaulis excentricus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Astex_2359
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Astex_2359
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Astex_2359
Enzymes [BR:aex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Astex_2359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(2563986..2564804)
Genome map
AA seq 272 aa AA seqDB search
MSVARIDARFAELKAQNRAAFVSYIMAGDPDLDTSFDLLKGLVEAGADIIELGFPFSDPM
AEGPIIQLAAERSLKNGTRMADVFALASRFRESDAKTPLILMGYMNPVENMGYPAFAEAC
AKAGVDGVIVVDCPPEEAERLIDALDAADVALIRLITPTSDDNRLKTLVKRTKGFVYYVS
VAGVTGVKEADAEGIREAVSHVREVANLPVVVGFGIKTPERAAEVARIADGSVVGSVLVD
AVAKSLLENSPSNTKVLETASLLAQAVRNARN
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagtcgcgcgtatcgacgcccgcttcgccgaactcaaggcgcagaatcgggcggct
tttgtctcctacatcatggccggcgatccggacctcgatacctctttcgaccttttgaaa
gggttggtggaggccggggccgatattatcgagctgggcttcccgttttccgacccgatg
gccgaaggcccgatcatccagctggccgccgaacgctcgctgaagaatggcacgcgtatg
gccgacgtttttgcgctggcttcacgctttcgtgaatccgacgccaaaaccccgctcatt
ctgatgggctatatgaaccccgttgagaatatgggctatccggcctttgctgaagcctgt
gccaaagccggggttgatggggtgatcgtcgtcgattgtccgccggaagaggccgagcgt
ttgatcgatgcgctcgatgccgctgacgtggccctgatccgcctgataacgccgacgagc
gacgacaatcgtctgaaaacgctggtgaagcgcacgaagggcttcgtctactacgtctcc
gtggcaggcgtcaccggcgtaaaggaagccgacgccgaggggatccgcgaggccgtgtcc
catgtgcgtgaggttgccaacctgcccgttgtggtgggcttcggcatcaagacgccagag
cgtgccgccgaagtcgcccgtatcgccgacggcagcgttgtcggttccgtgctggtagac
gcagtagcgaaatctttacttgaaaattccccatccaacacaaaagtgctggaaaccgcg
agccttttggctcaggctgtccgtaacgcgagaaactag

DBGET integrated database retrieval system