KEGG   Asticcacaulis excentricus: Astex_2359Help
Entry
Astex_2359        CDS       T01378                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00260  Glycine, serine and threonine metabolism
aex00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01130  Biosynthesis of antibiotics
aex01230  Biosynthesis of amino acids
Module
aex_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Astex_2359
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Astex_2359
Enzymes [BR:aex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Astex_2359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ADU14012
JGI: Astex_2359
UniProt: E8RNB3
Position
1:complement(2563986..2564804)
Genome map
AA seq 272 aa AA seqDB search
MSVARIDARFAELKAQNRAAFVSYIMAGDPDLDTSFDLLKGLVEAGADIIELGFPFSDPM
AEGPIIQLAAERSLKNGTRMADVFALASRFRESDAKTPLILMGYMNPVENMGYPAFAEAC
AKAGVDGVIVVDCPPEEAERLIDALDAADVALIRLITPTSDDNRLKTLVKRTKGFVYYVS
VAGVTGVKEADAEGIREAVSHVREVANLPVVVGFGIKTPERAAEVARIADGSVVGSVLVD
AVAKSLLENSPSNTKVLETASLLAQAVRNARN
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagtcgcgcgtatcgacgcccgcttcgccgaactcaaggcgcagaatcgggcggct
tttgtctcctacatcatggccggcgatccggacctcgatacctctttcgaccttttgaaa
gggttggtggaggccggggccgatattatcgagctgggcttcccgttttccgacccgatg
gccgaaggcccgatcatccagctggccgccgaacgctcgctgaagaatggcacgcgtatg
gccgacgtttttgcgctggcttcacgctttcgtgaatccgacgccaaaaccccgctcatt
ctgatgggctatatgaaccccgttgagaatatgggctatccggcctttgctgaagcctgt
gccaaagccggggttgatggggtgatcgtcgtcgattgtccgccggaagaggccgagcgt
ttgatcgatgcgctcgatgccgctgacgtggccctgatccgcctgataacgccgacgagc
gacgacaatcgtctgaaaacgctggtgaagcgcacgaagggcttcgtctactacgtctcc
gtggcaggcgtcaccggcgtaaaggaagccgacgccgaggggatccgcgaggccgtgtcc
catgtgcgtgaggttgccaacctgcccgttgtggtgggcttcggcatcaagacgccagag
cgtgccgccgaagtcgcccgtatcgccgacggcagcgttgtcggttccgtgctggtagac
gcagtagcgaaatctttacttgaaaattccccatccaacacaaaagtgctggaaaccgcg
agccttttggctcaggctgtccgtaacgcgagaaactag

DBGET integrated database retrieval system