KEGG   Asticcacaulis excentricus: Astex_2360Help
Entry
Astex_2360        CDS       T01378                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aex  Asticcacaulis excentricus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Astex_2360
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Astex_2360
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Astex_2360
Enzymes [BR:aex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Astex_2360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(2564807..2566036)
Genome map
AA seq 409 aa AA seqDB search
MDDAILTNRYNMPDAKGRFGEFGGLYVPETLMPLVLELGEAWAQAKEDEAFWAEYHHLLK
YFVGRPSPLYLAERLTEYFGGAKIYFKREELNHTGAHKINNCIGQILLARRMGRTRIIAE
TGAGQHGVASATVCAKFDLPCTVYMGALDVERQKPNVFRMQLMGTKVHPVTNGNGTLKDA
MNEALRDWVTNVHDTYYMIGTAAGMHPYPEMVRDFQTIIGKETRQQILEAEGRLPDAVIA
CVGGGSNAIGMFHPFIDDESVKIVGVEAAGHGLDVYNGHAASLNGGRPGVLHGNRTYLLQ
DEDGQILEGHSISAGLDYPGIGPEHAHLFDTGRARYVYATDEEALEAFQLTSRLEGIIPA
LESSHAIARLGDLAKEIGKGGVIVLNLSGRGDKDIFTVAKALGQQMGNL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggatgatgccatcctgaccaatcgctacaatatgccggacgccaagggccgtttcggt
gagttcggtgggctttatgtccccgaaacccttatgccgctcgttctcgaactgggcgaa
gcgtgggcgcaggcgaaagaggatgaggccttctgggcggagtaccaccatcttctcaaa
tattttgtcggtcgcccgagcccgctgtatctggcggagcgcctgacagagtattttggt
ggcgccaaaatctatttcaagcgcgaagaactgaaccacaccggcgcgcataagatcaat
aactgcatcggtcagatcctgctggcgcgccgtatgggccgcacgcgaattatcgctgaa
accggggccggtcagcacggtgtcgcttctgctaccgtgtgcgcgaagttcgatcttccg
tgtacggtctatatgggtgcgctcgacgtcgaacgccaaaaacccaatgttttccgtatg
caactgatgggcaccaaggtgcacccggtgaccaatggtaatggcacgctgaaagacgcc
atgaacgaggcgctgcgtgactgggtcaccaatgtccacgatacctattatatgattggc
accgccgccggcatgcacccctatccggagatggtgcgcgactttcagaccatcatcggc
aaggagacgcgccaacagattctggaggccgaaggccgcctgcctgacgctgttatcgcc
tgcgtcggtgggggttcgaacgccatcggcatgttccaccccttcattgatgatgagagc
gtgaagatcgtcggtgttgaagccgccggtcacgggcttgatgtctataatggccacgcg
gcctcgctgaacggcggccgaccgggcgttttgcacggcaaccgcacctatctgcttcag
gatgaggacgggcagatccttgaagggcactcgatttcggccggtctcgactatcctggc
attgggccggaacacgcgcacctgttcgacacgggtcgcgcccgttacgtctatgccacg
gacgaggaggctctggaggccttccagctgacgtcgcgccttgaaggcattatcccggcg
ctcgaatcctcgcacgccatcgcccgcctgggtgatctggccaaggagatcggtaagggc
ggcgtcatcgtgctcaacctttcgggtcggggcgataaagacattttcaccgtcgccaag
gcgctcggtcagcaaatggggaatctctaa

DBGET integrated database retrieval system