KEGG   Asticcacaulis excentricus: Astex_2360Help
Entry
Astex_2360        CDS       T01378                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00260  Glycine, serine and threonine metabolism
aex00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01130  Biosynthesis of antibiotics
aex01230  Biosynthesis of amino acids
Module
aex_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Astex_2360
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Astex_2360
Enzymes [BR:aex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Astex_2360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADU14013
JGI: Astex_2360
UniProt: E8RNB4
Position
1:complement(2564807..2566036)
Genome map
AA seq 409 aa AA seqDB search
MDDAILTNRYNMPDAKGRFGEFGGLYVPETLMPLVLELGEAWAQAKEDEAFWAEYHHLLK
YFVGRPSPLYLAERLTEYFGGAKIYFKREELNHTGAHKINNCIGQILLARRMGRTRIIAE
TGAGQHGVASATVCAKFDLPCTVYMGALDVERQKPNVFRMQLMGTKVHPVTNGNGTLKDA
MNEALRDWVTNVHDTYYMIGTAAGMHPYPEMVRDFQTIIGKETRQQILEAEGRLPDAVIA
CVGGGSNAIGMFHPFIDDESVKIVGVEAAGHGLDVYNGHAASLNGGRPGVLHGNRTYLLQ
DEDGQILEGHSISAGLDYPGIGPEHAHLFDTGRARYVYATDEEALEAFQLTSRLEGIIPA
LESSHAIARLGDLAKEIGKGGVIVLNLSGRGDKDIFTVAKALGQQMGNL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggatgatgccatcctgaccaatcgctacaatatgccggacgccaagggccgtttcggt
gagttcggtgggctttatgtccccgaaacccttatgccgctcgttctcgaactgggcgaa
gcgtgggcgcaggcgaaagaggatgaggccttctgggcggagtaccaccatcttctcaaa
tattttgtcggtcgcccgagcccgctgtatctggcggagcgcctgacagagtattttggt
ggcgccaaaatctatttcaagcgcgaagaactgaaccacaccggcgcgcataagatcaat
aactgcatcggtcagatcctgctggcgcgccgtatgggccgcacgcgaattatcgctgaa
accggggccggtcagcacggtgtcgcttctgctaccgtgtgcgcgaagttcgatcttccg
tgtacggtctatatgggtgcgctcgacgtcgaacgccaaaaacccaatgttttccgtatg
caactgatgggcaccaaggtgcacccggtgaccaatggtaatggcacgctgaaagacgcc
atgaacgaggcgctgcgtgactgggtcaccaatgtccacgatacctattatatgattggc
accgccgccggcatgcacccctatccggagatggtgcgcgactttcagaccatcatcggc
aaggagacgcgccaacagattctggaggccgaaggccgcctgcctgacgctgttatcgcc
tgcgtcggtgggggttcgaacgccatcggcatgttccaccccttcattgatgatgagagc
gtgaagatcgtcggtgttgaagccgccggtcacgggcttgatgtctataatggccacgcg
gcctcgctgaacggcggccgaccgggcgttttgcacggcaaccgcacctatctgcttcag
gatgaggacgggcagatccttgaagggcactcgatttcggccggtctcgactatcctggc
attgggccggaacacgcgcacctgttcgacacgggtcgcgcccgttacgtctatgccacg
gacgaggaggctctggaggccttccagctgacgtcgcgccttgaaggcattatcccggcg
ctcgaatcctcgcacgccatcgcccgcctgggtgatctggccaaggagatcggtaagggc
ggcgtcatcgtgctcaacctttcgggtcggggcgataaagacattttcaccgtcgccaag
gcgctcggtcagcaaatggggaatctctaa

DBGET integrated database retrieval system