KEGG   Asticcacaulis excentricus: Astex_2362Help
Entry
Astex_2362        CDS       T01378                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
aex  Asticcacaulis excentricus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Astex_2362
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Astex_2362
   00052 Galactose metabolism
    Astex_2362
   00500 Starch and sucrose metabolism
    Astex_2362
   00520 Amino sugar and nucleotide sugar metabolism
    Astex_2362
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Astex_2362
   00524 Butirosin and neomycin biosynthesis
    Astex_2362
Enzymes [BR:aex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Astex_2362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2566840..2567784
Genome map
AA seq 314 aa AA seqDB search
MTAVLLSDLSNSAHMKLALVTPGARPTEATLYPCKSIEEFNASIIDFLEANNQPELMAAA
VSACGWEVDGGFSMPNHGYRIDRQHLRDLLNIQRLHVVNDCVCKAMAVDRLFTSELVKVC
GGEGEDGQARALVGAGRGLGLAGIIMDDLGHPTVLPCEGGHADLAVTTPREAQVFEHLER
KYGHVSRERVVSMQGLAEIYEILGQVDAGDNRRVNASEVVALAHTDDARALEAVSLSQGF
LAAMASDTALMLGARGGIYLAGEYVELISDLIDWSAFEARFNDKGRLRGYMQDIPVFFVR
ARDLELIGLATLFG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgttcttttgagcgatctctccaatagcgctcacatgaagctggcacttgta
acgccaggggcgcgcccgacagaggcaaccctttatccatgcaagtcgatcgaagaattt
aacgcttccataatcgattttctcgaagccaacaaccagcccgaactgatggcggccgcg
gtttcagcgtgcggctgggaagtggatggcgggttttccatgcccaaccatggctaccgc
atcgaccgtcagcatctgcgcgaccttctgaacattcagcgcctgcacgttgtcaatgac
tgtgtatgtaaggccatggcggtggatcgtctgttcacctccgagctcgtcaaggtctgc
ggcggcgaaggcgaggacgggcaggcccgcgcactggtcggggccggacgcggacttggg
ctggccggcataattatggatgatctggggcatccgaccgtgctgccctgcgagggcggt
catgccgatctggcagtgacaacgccgcgtgaagcgcaggtttttgagcatctggagcgc
aaatacggccacgtctcgcgcgagcgcgtcgtcagtatgcagggtctggcagaaatctat
gaaattttagggcaggtcgatgcgggcgataaccgccgcgtgaatgcttccgaagtggtc
gccttggcccataccgatgatgcacgtgcgcttgaagccgtcagcctcagtcagggtttt
ctggccgctatggcctccgacacggctctaatgctgggggcgcgcggtggcatctatctg
gcgggcgagtatgtggaactgatcagcgacctgatcgactggtccgcctttgaggcgcgt
ttcaatgacaaggggcgcttgcgcggctatatgcaggacataccggtctttttcgtccgg
gcgcgcgacctggaactgatcggtctggcgacgctgttcgggtaa

DBGET integrated database retrieval system