KEGG   Asticcacaulis excentricus: Astex_2497Help
Entry
Astex_2497        CDS       T01378                                 

Definition
glycoside hydrolase family 5
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aex  Asticcacaulis excentricus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Astex_2497
Enzymes [BR:aex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Astex_2497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:133961..135496
Genome map
AA seq 511 aa AA seqDB search
MIRNTFAGSLGAAILALMAFGPQAAQAEMSPQAQVAAMKRGVNVLGYDPLWKDPAKARFQ
PRLMSVIREGGFNTVRINLHAFQHMDKDNRLSPFYFSTLDTMVDAANKAGLHVILDLHNF
NECAEDVKACRPKIMAFWTQMAEHYKDAPDTVMFEILNEPHGPVNAVWNDMIAENLKIIR
KTNPRRNVIVGPTSWNNLNDLEGLRLPAEDLHLIVTFHYYEPFVFTHQGAAWTPDFKDVK
GVAWTKAEGQARLDADFDKVKAWSARTGRPILLGEFGAYDKGPLDSRVAYTDAVARAAEA
RNWAWAYWQFDSDFIVYDIPADRWVKPIHGALIPEQAAKVEAAQTPPVDPNDVMAHVINT
PKLSSWNAYGAPQAAAPVQTAEGAPIRSALRIPLSAAQPNAWDVGSVAPITQSVKKGDKL
QAWVWARAATPDTATRVPLNILISLNKAPWTALVNTPVQISSEWDMYVVQAVADKDYEAG
TIMLSLQLGKSAYPIELGAPVVLRNYAPTAQ
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcaacaccttcgcaggtagccttggcgcggccattctggcgctcatggccttc
gggccgcaggcggctcaggccgagatgtcacctcaggctcaggtcgccgccatgaagcgc
ggcgtcaatgtgctgggctatgatcccctttggaaggaccccgccaaggcgcgttttcaa
ccgcgtctgatgtcggtgatccgtgagggtggcttcaacacggttcgtatcaacctccat
gcatttcagcacatggacaaggataaccgcctgtcgcccttctatttttccaccctcgat
accatggtagacgcggcgaataaggccggtttgcacgtcattctggacctgcacaacttc
aatgagtgcgctgaggatgtgaaggcctgccggccgaagatcatggccttctggacgcag
atggcggagcattacaaggatgcgcccgacaccgtcatgttcgagattttgaacgagccg
cacggcccggtaaatgccgtgtggaacgacatgatcgccgaaaatctgaaaatcatccgc
aagaccaatccgcggcgcaatgttattgtcggcccgacctcgtggaacaatctcaatgat
ctggaaggcttgcgcctgccggccgaagatttgcatctgatcgtcaccttccactattac
gagccctttgtctttacccatcagggagcggcgtggacgccggacttcaaggatgtgaag
ggcgtcgcgtggaccaaagccgaggggcaggcccgccttgacgccgatttcgacaaggtg
aaggcgtggagcgcccgcaccggacgcccgatcctgctgggcgaattcggggcctatgac
aaggggccgctcgacagccgcgtggcctatacggacgccgtggcgcgggcggctgaggcg
cgcaactgggcgtgggcttactggcagttcgattctgactttatcgtctatgacataccg
gcggatcgctgggtcaagccgattcacggcgcgctgatccccgaacaggcggcgaaggtc
gaggcggcgcaaacgcctccggtcgatcccaatgacgtcatggctcacgtcatcaatacg
cccaaactgtcgtcgtggaacgcctatggtgccccacaggctgcggccccagtgcagacg
gccgaaggcgcgcccattcgttcggccctgcgcatccctttgtcggcggcgcagcccaat
gcctgggatgtcggcagcgtggccccgatcacgcaatcggtaaaaaagggcgacaaactt
caggcatgggtgtgggcccgtgcggctacgcctgatacggcgacgcgcgtgccgctgaac
atcctcatctcgctcaacaaggccccatggacagcactggtcaacacaccggttcagatt
tcatccgaatgggacatgtatgtggtgcaggccgtggccgacaaggactatgaggcgggt
acaattatgctgagcctgcaattgggcaagtcggcctatcccatcgaactgggcgccccg
gtggtactacgcaactacgcaccgaccgcgcagtag

DBGET integrated database retrieval system