KEGG   Asticcacaulis excentricus: Astex_2589Help
Entry
Astex_2589        CDS       T01378                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00052  Galactose metabolism
aex00561  Glycerolipid metabolism
aex00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Astex_2589
  Lipid metabolism
   00561 Glycerolipid metabolism
    Astex_2589
   00600 Sphingolipid metabolism
    Astex_2589
Enzymes [BR:aex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Astex_2589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Melibiase Glyco_hydro_97 Melibiase_2_C Raffinose_syn
Motif
Other DBs
NCBI-ProteinID: ADU14234
JGI: Astex_2589
UniProt: E8RV34
Position
2:complement(235174..236679)
Genome map
AA seq 501 aa AA seqDB search
MRKLFLGLSVVFTLLLPVSQALAKPPEGGWVFDSSPNYPDFTRVIIKETGGKLTGVITSR
WYGDLPMQDLRAEGDTLVFKINNGNPRVTPTGIVIKAEGISIRMTGNLWYQSFNLTAHKG
SKRELKALDFQVYPLPPYRVVPQKALAPTPPMGWNSWNRFNTEIDDKTVREIADALVSSG
LRDAGYVYVNIDDGWQGMRDADGVLMPNAKFPDMKALADYVHSRGLKIGIYSSQGPKTCG
GYEGSYGHVEQDARTFANWGMDYLKYDLCSGEAFYYTKEAVYASYQQMGEALAATGRDIV
FSLCQYGRFDVGSWGRDVGGHLWRTTGDIEDNYARMAWIGFDANGKPNHTGPNGWNDPDM
LEVGNGGMTTDEYKTHMSLWALMAAPLLLGNDVRSMTPETAAILSNRDVIAIDQDIAGVQ
GLPVKKDATHEIWTKKLSDGATAVGLFNHSDRPITLSGEWAQIGLGGASEVRDLWTHTNT
RSDKAYSYTLPAHGVVMLKVR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaactatttttaggtctatctgtggtgttcaccctgttactgcccgtgtctcag
gctctggcgaaaccgccagagggcggctgggttttcgacagctcacccaactatccggat
tttacgcgtgtcatcatcaaagagacaggcggtaagctgacgggggtgatcacctcccgc
tggtatggcgacctgcctatgcaggatctgcgtgccgaaggcgatacgctcgtcttcaaa
atcaacaacggtaatccgcgcgtgaccccgaccggcatcgtcatcaaggccgagggcatc
tcgatccgcatgaccggcaacctgtggtatcagagcttcaacctcaccgcacacaagggc
tcaaagcgtgaactaaaggcccttgatttccaggtctatcccctgcccccttaccgcgtc
gttcctcagaaggcgctggcccctaccccgcccatgggatggaattcgtggaaccggttc
aatacggagatcgacgataagaccgtgcgcgaaatcgctgacgcactggtcagcagcggc
ctgagggatgccggttatgtctacgttaatattgatgacggctggcaggggatgcgcgat
gccgatggcgtgctaatgcccaatgccaagttccccgacatgaaagctcttgccgactac
gtccattccagggggctgaagatcggcatctattcctcacagggaccgaagacctgcggg
ggctatgagggatcgtacggccatgtcgaacaggacgcgcgcacctttgccaactggggt
atggattatctaaaatacgatctctgctctggcgaggccttttactataccaaagaagcc
gtctacgcctcctatcagcagatgggcgaggcgctggcggcgaccggccgcgatattgtc
ttcagcctgtgccagtacgggcgtttcgatgtcggatcatgggggcgtgacgtcggtggc
cacctgtggcgcaccacaggcgatattgaggacaattacgcacgcatggcgtggatcggc
tttgatgccaacggcaagcccaaccacaccggtccgaatggctggaacgatccggacatg
ctcgaagtcggcaatggcggcatgacaacggatgaatacaagacccatatgtcgctgtgg
gccctcatggctgcgccgctgctgttgggcaatgacgtacgcagcatgacccccgaaacc
gcggctattctgagcaaccgtgatgtcatcgccatcgatcaggacatagccggtgtgcag
gggctgccggtgaaaaaggacgctacccacgaaatctggaccaaaaaactgagtgacggc
gccaccgccgtcggcctgttcaaccactctgacaggccgatcaccctgtcgggtgaatgg
gcgcagataggacttggcggcgcgtccgaagtgcgtgacttgtggacgcacaccaatacc
cgttcagacaaagcttacagctacaccctccccgctcacggtgtggtcatgctcaaggtg
cggtag

DBGET integrated database retrieval system