KEGG   Asticcacaulis excentricus: Astex_2725Help
Entry
Astex_2725        CDS       T01378                                 

Definition
glycoside hydrolase family 35
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
aex  Asticcacaulis excentricus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Astex_2725
Enzymes [BR:aex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Astex_2725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:388126..389967
Genome map
AA seq 613 aa AA seqDB search
MMDRRQILGGLAASAVTLGFSAGDASAAPSRFTIKDDQFLLDGQPLHLMAGEMHYPRIPR
ELWRDRLRKLKALGLNTLSTYTFWSAHEKKPGVYDFSGNLDVAAWVKMAQEEGLHVLLRP
GPYACAEWDNGGYPAWFLNDPDIRPRSLDPRYMGPSGQWLKRLGQEVAHLEIDKGGPVLM
TQIENEYGSYGNDLNYMRAVRDQVRAAGFSGQLYTVDGAAVIENGALPELFNGINFGTYD
KAEGEFARYAKFKTKGPRMCTELWGGWFDHFGEVHSNMEISPLMESLKWMLDNRISFSFY
MLHGGTSFAFDAGANFHKTHGYQPDISSYDYDAMLDEAGRVTPKYEAARELFRRYLPPER
FTALPEPEKALKIERFALRETAPLSQLYPKGTSHPQPKTFEQMGQNHGLMLYRHAAKTAV
SGHLKMADVRDYALVSAGQTRFGTLDRRLKETEIEVSLKAGDTLDLLIDAMGHVNYGDQI
GKDQKGLIGPVTLNGKPLTGWTHQGVPLDDLSVLRFKRQRVNGPAFYRGTFETSEAGFTF
LDLRGWGKGYVWVNGHNLGRYWSVGPQRAVFVPAPYLKRGVNEVVVLDLHDQGERSLAGS
GSQIWDLPGLVKG
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgatggatcgcagacagattctcggtgggctggccgcttcggcggtaacgctcggtttt
tcagccggtgacgccagcgcggccccgtcgcgctttacgataaaggacgatcagttcctg
ctggacggacagcctctgcacctgatggcgggtgagatgcactatccacgcatcccgcgc
gaactgtggcgtgatcgtctgcgtaagctgaaggcgctggggctgaacacgctctcgacc
tacaccttctggagcgcgcatgagaaaaagcccggcgtctatgatttcagcggcaatctc
gatgtcgccgcatgggtgaagatggcgcaggaagaggggctgcacgtcctgttgcggccc
ggcccctatgcctgtgctgaatgggacaatggcggctatccggcctggttcctcaatgac
ccggacatccgcccgcgttcgctcgatccgcgctatatgggcccgtcagggcagtggctg
aagcggctggggcaggaggtggcgcaccttgagatcgacaagggcggcccggtcctgatg
acgcagatcgagaacgaatacggctcctacggcaacgatctcaactatatgcgcgccgtc
cgcgatcaggtgcgcgccgccggtttcagcggtcagctttatacggtcgatggggcggcg
gtcatcgagaacggcgccttgccggagctgtttaacggcatcaatttcggcacctatgac
aaggcggaaggcgagtttgcgcgctatgccaagttcaagaccaagggcccgcgcatgtgt
accgagctgtggggcggctggttcgaccacttcggtgaggtgcattccaatatggaaatc
tcgcctctgatggagagcctcaaatggatgctcgataaccgcatcagcttctccttttat
atgctgcacggaggcacctcgtttgcctttgacgccggggccaacttccacaagacccac
ggctatcagccggatatttcgagctatgattacgacgccatgctggatgaggccgggcgc
gtcacgccgaaatacgaggcggcgcgcgagctgttccgtcgctacctgccgccggagcgt
ttcaccgctttgccggaaccggaaaaggccctcaaaattgagcgcttcgccctgcgtgaa
accgcgcccctgtcgcaactctacccgaaggggaccagccacccgcaacccaaaaccttt
gagcagatggggcaaaatcatggcctgatgctgtatcgccacgcggccaagacggctgtt
tccggccatctgaaaatggctgatgtgcgcgactatgccctcgtcagcgccggtcagacg
cgcttcggaacgctggatcgccgcctgaaagagaccgagattgaggtgtcgctgaaggct
ggggatacgctcgacctgctgatcgacgctatgggccacgtcaactatggcgatcagatc
ggcaaggatcagaaggggctgatcgggccggtgaccctgaacggcaagccgctcaccggc
tggacgcatcagggcgtgccgctcgatgacctgagcgtcttgcgcttcaagcggcagcgc
gttaatggcccggccttttatcgcggcacgtttgaaacctcagaggcgggcttcaccttc
cttgacctgcgcggctggggcaagggctatgtctgggtcaatggccacaatctgggccgc
tactggtccgttgggccgcagcgcgccgtcttcgtcccggccccctatctcaagaggggt
gtcaatgaggtggtggtgcttgatctccatgatcagggcgaacgctcactggccggttcg
ggatcgcagatctgggacctgccgggtctggtgaagggatag

DBGET integrated database retrieval system