KEGG   Asticcacaulis excentricus: Astex_2771Help
Entry
Astex_2771        CDS       T01378                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
aex  Asticcacaulis excentricus
Brite
Enzymes [BR:aex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Astex_2771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:complement(440428..441486)
Genome map
AA seq 352 aa AA seqDB search
MSNDIEVSVRSSNAYSLAVEAIRLMEVHGVWPTPLNYEIWLYVAGDPNSALAQEIHRLIG
SGEKITEEISESLASKFISRLKLNDEVRDAGLRLTRELASVSEVISEAQKAQKDYNETLE
GARSSIDGDSDAQRLRQLVGRLTDATSQILNQHAHFEVRLSESSREVARLRKHLDQVRLE
AMTDALTNLANRKSFDEALERHCDSDEGKNITLAVLDIDHFKRFNDTWGHQTGDQVLRYV
ASVLSRIGRAPRMAARYGGEEFAMIFPSENMAVVERLLNEARQEIASRVLKRRSTNEDLG
TITISVGIAERDYGEDAYDLLDRADKALYQSKNNGRNMVTCAKSALKATDAA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgacatagaagtgagcgttcgcagttccaatgcctatagcctggcagtcgag
gccattcggcttatggaagtgcacggggtctggccgacgccgctcaattatgaaatctgg
ctctatgtcgcgggcgatcccaactcggctctggcgcaggaaattcatcgcctgatcggt
tcgggtgagaagattaccgaggaaatctccgaaagcctcgcttcgaaattcatttcccgc
ctcaagctgaatgacgaagtgcgcgacgcaggcctgcgtctgacgcgtgagttggcctcg
gtcagcgaagtcatcagcgaagcccagaaggcgcagaaagactataacgagactctagaa
ggcgcacgcagcagcatcgacggtgattccgatgcacaacgcctgcgccagctagtcggg
cgtctgacggacgccacctcgcaaatcctaaaccagcacgcccatttcgaggttcgcctc
agcgagtcctcacgcgaagtggcacgtctgcgtaaacacctcgatcaggtgcgcctggaa
gccatgaccgacgccctgaccaatctggccaatcgcaaatccttcgacgaagcgctggaa
cgccactgcgacagcgacgaaggcaagaatatcactctggccgttctcgatatcgaccat
ttcaaacgcttcaacgacacctggggccatcagacgggcgatcaggtcctgcgttacgtc
gcctcagtcctgtcgcgcattggtcgcgccccacgcatggccgcgcgctacggcggtgaa
gaatttgctatgattttccccagcgaaaatatggctgtcgtcgagcgtctgctcaacgaa
gcgcgacaggaaatcgcctcccgcgtgctcaagcgccgttccacgaatgaagatcttggc
acgatcacgatttctgttggcatcgccgagcgtgactacggcgaagacgcctacgacctg
cttgatcgcgccgacaaggccctctatcagtcgaagaataacggtcgcaacatggtcacc
tgtgccaaatcggccttgaaagcgaccgacgccgcctga

DBGET integrated database retrieval system