KEGG   Asticcacaulis excentricus: Astex_2771Help
Entry
Astex_2771        CDS       T01378                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
aex  Asticcacaulis excentricus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(440428..441486)
Genome map
AA seq 352 aa AA seqDB search
MSNDIEVSVRSSNAYSLAVEAIRLMEVHGVWPTPLNYEIWLYVAGDPNSALAQEIHRLIG
SGEKITEEISESLASKFISRLKLNDEVRDAGLRLTRELASVSEVISEAQKAQKDYNETLE
GARSSIDGDSDAQRLRQLVGRLTDATSQILNQHAHFEVRLSESSREVARLRKHLDQVRLE
AMTDALTNLANRKSFDEALERHCDSDEGKNITLAVLDIDHFKRFNDTWGHQTGDQVLRYV
ASVLSRIGRAPRMAARYGGEEFAMIFPSENMAVVERLLNEARQEIASRVLKRRSTNEDLG
TITISVGIAERDYGEDAYDLLDRADKALYQSKNNGRNMVTCAKSALKATDAA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgacatagaagtgagcgttcgcagttccaatgcctatagcctggcagtcgag
gccattcggcttatggaagtgcacggggtctggccgacgccgctcaattatgaaatctgg
ctctatgtcgcgggcgatcccaactcggctctggcgcaggaaattcatcgcctgatcggt
tcgggtgagaagattaccgaggaaatctccgaaagcctcgcttcgaaattcatttcccgc
ctcaagctgaatgacgaagtgcgcgacgcaggcctgcgtctgacgcgtgagttggcctcg
gtcagcgaagtcatcagcgaagcccagaaggcgcagaaagactataacgagactctagaa
ggcgcacgcagcagcatcgacggtgattccgatgcacaacgcctgcgccagctagtcggg
cgtctgacggacgccacctcgcaaatcctaaaccagcacgcccatttcgaggttcgcctc
agcgagtcctcacgcgaagtggcacgtctgcgtaaacacctcgatcaggtgcgcctggaa
gccatgaccgacgccctgaccaatctggccaatcgcaaatccttcgacgaagcgctggaa
cgccactgcgacagcgacgaaggcaagaatatcactctggccgttctcgatatcgaccat
ttcaaacgcttcaacgacacctggggccatcagacgggcgatcaggtcctgcgttacgtc
gcctcagtcctgtcgcgcattggtcgcgccccacgcatggccgcgcgctacggcggtgaa
gaatttgctatgattttccccagcgaaaatatggctgtcgtcgagcgtctgctcaacgaa
gcgcgacaggaaatcgcctcccgcgtgctcaagcgccgttccacgaatgaagatcttggc
acgatcacgatttctgttggcatcgccgagcgtgactacggcgaagacgcctacgacctg
cttgatcgcgccgacaaggccctctatcagtcgaagaataacggtcgcaacatggtcacc
tgtgccaaatcggccttgaaagcgaccgacgccgcctga

DBGET integrated database retrieval system