KEGG   Asticcacaulis excentricus: Astex_2793Help
Entry
Astex_2793        CDS       T01378                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00230  Purine metabolism
aex01100  Metabolic pathways
Module
aex_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Astex_2793
Enzymes [BR:aex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Astex_2793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 AAA_22 cobW Thymidylate_kin
Motif
Other DBs
NCBI-ProteinID: ADU14431
JGI: Astex_2793
UniProt: E8RSG0
Position
2:468183..468824
Genome map
AA seq 213 aa AA seqDB search
MPNSQRLRRGLMLIVSSPSGAGKTSLCRRLMADHADLDLSISVTTRSPRPGEKDGREYHF
ISDAAMDDLVKNDALLEWAAVHDHRYGSPREPVEKALSQGQNVLFDIDWQGAQRISAKAP
SDVVRVFILPPSMEELKRRLYARAQDADDVIQRRLSRAKGEIAHWAEYDYVILNDDFDRS
YAELVHIYHSETARRSRGLWIAPFVDELMSEPL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcctaattcccaacgtcttcgccgcggccttatgctgattgtttcctcgccttcgggc
gcgggcaagacctctctgtgccgtcgcctgatggccgatcacgccgatctcgacctgtcg
atttcggtgaccacccgctcaccgcgccccggtgaaaaggatggccgcgaatatcacttc
atcagcgacgccgcgatggatgatctggtcaaaaacgacgccctgctggaatgggcggcg
gtgcacgaccaccgctatggctcgccacgtgaaccggtggaaaaagccttgtcgcagggg
cagaacgtgctgttcgatatcgactggcagggggcgcagcgcatctcggccaaggcgccg
tcggatgtggtgcgtgtctttatcctaccgccctcgatggaagaactgaagcgccgcctt
tatgcccgcgcgcaggacgctgatgacgtcatccagcgccgtcttagccgcgccaaaggt
gagatcgcgcactgggccgaatacgactacgttattctgaatgatgatttcgaccgctcc
tatgctgaactggtgcacatctatcattcggaaacggcgcgccgttcacgtggtttgtgg
atcgccccgtttgtcgatgagctgatgagcgagccgctttag

DBGET integrated database retrieval system