KEGG   Asticcacaulis excentricus: Astex_2794Help
Entry
Astex_2794        CDS       T01378                                 

Definition
cytochrome c class i
Orthology
K08738  
cytochrome c
Organism
aex  Asticcacaulis excentricus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Astex_2794
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Astex_2794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(468902..469405)
Genome map
AA seq 167 aa AA seqDB search
MRAALFFAPLTLALCLSGCGDKPAETASETAAPQASVPAVEGPSEAEKAAKLAALPAPYN
TADLKAGEKAWTKCRSCHTLVEGGANMVGPNLYGVFGRKSGSKADYQYSDAMKGHNAVWD
FATLDDYITHPQATVPGTKMGFMGLKDETERHNLIAYLKVETSPAQK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagccctgttttttgcccccctgacccttgccctgtgtctgtcaggctgcggc
gacaaacccgcagaaacggcaagcgaaaccgctgcaccacaagccagtgtgccggcggtc
gagggaccgtccgaagcggaaaaagccgcaaaacttgctgccctgcccgccccctacaat
acggccgatctcaaggcgggtgagaaggcgtggaccaagtgtcgctcgtgccatacgctg
gtcgaaggcggggccaatatggtcggccccaacctttacggcgtgttcgggcgcaagtca
ggcagcaaggccgattatcagtatagcgacgcgatgaaaggccacaacgccgtgtgggac
tttgctacgctcgatgactatatcacccatccgcaggcaaccgtccccggcaccaagatg
ggctttatgggccttaaggacgagacggagcgtcacaatctgatcgcctatctcaaggtc
gaaaccagcccggcccagaagtaa

DBGET integrated database retrieval system