KEGG   Asticcacaulis excentricus: Astex_2794Help
Entry
Astex_2794        CDS       T01378                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
aex  Asticcacaulis excentricus
Pathway
aex02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aex00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Astex_2794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ADU14432
JGI: Astex_2794
UniProt: E8RSG1
Position
2:complement(468902..469405)
Genome map
AA seq 167 aa AA seqDB search
MRAALFFAPLTLALCLSGCGDKPAETASETAAPQASVPAVEGPSEAEKAAKLAALPAPYN
TADLKAGEKAWTKCRSCHTLVEGGANMVGPNLYGVFGRKSGSKADYQYSDAMKGHNAVWD
FATLDDYITHPQATVPGTKMGFMGLKDETERHNLIAYLKVETSPAQK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagccctgttttttgcccccctgacccttgccctgtgtctgtcaggctgcggc
gacaaacccgcagaaacggcaagcgaaaccgctgcaccacaagccagtgtgccggcggtc
gagggaccgtccgaagcggaaaaagccgcaaaacttgctgccctgcccgccccctacaat
acggccgatctcaaggcgggtgagaaggcgtggaccaagtgtcgctcgtgccatacgctg
gtcgaaggcggggccaatatggtcggccccaacctttacggcgtgttcgggcgcaagtca
ggcagcaaggccgattatcagtatagcgacgcgatgaaaggccacaacgccgtgtgggac
tttgctacgctcgatgactatatcacccatccgcaggcaaccgtccccggcaccaagatg
ggctttatgggccttaaggacgagacggagcgtcacaatctgatcgcctatctcaaggtc
gaaaccagcccggcccagaagtaa

DBGET integrated database retrieval system