KEGG   Asticcacaulis excentricus: Astex_2849Help
Entry
Astex_2849        CDS       T01378                                 

Definition
1-deoxy-d-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
aex  Asticcacaulis excentricus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Astex_2849
Enzymes [BR:aex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Astex_2849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:526635..527858
Genome map
AA seq 407 aa AA seqDB search
MRRISILGSTGSIGVSTLNLIEETLTPGEDYELEALCAGRNAALLAEQALKFRPRVAVLS
DASQWADFSERMKGSGIEIACGPEAVEAAAARPVDWVMAAIVGIAGLRPVWAAAGTGATV
ALANKESLVCCGRSLILRAEAAGGRILPVDSEHNAIFQVFEEAERARIRRLILTASGGPF
RGRQREDLAHVTREQALKHPNWSMGAKITIDSASLANKGLELIEAAYLFDMPSAQIDVLI
HPQSVVHSLVEYSDGSTLAQMGPPDMRVPISYCLGWPQRHSWSAPPLDLCALSTLTFERP
DTEAFPMLRLAREALEAGGLMPVVYNAANEVMVQAFLEGRIGFLDIPATVEAAMMRAQSL
SMAFGNDLRHDVECIEQADAETRAQLAVSGEAAHWTAGTQGQAFSRA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtatctcaatcctcggttcgaccggctccatcggcgtatcaacgctgaacctg
atcgaagaaaccctgacgcctggcgaagattacgaactggaagccctgtgtgccggacgt
aatgcggcgctactggctgagcaggcgctgaaattccggccgcgtgtggcggtcctgtcc
gatgcttcgcaatgggccgatttcagcgaacggatgaagggctccggtatcgagatcgcc
tgcggtcctgaggccgtcgaagccgctgcggcgcgtccggtcgattgggtgatggcggct
attgtcggcattgcgggtttgaggcccgtctgggcggcggccgggacgggggctacagtg
gctttggccaacaaggaaagccttgtctgttgtggccgctcgctgatcctgcgcgctgag
gcagcgggcgggcgcattctaccggtcgattccgaacacaatgcgattttccaagtcttt
gaagaggccgagcgcgcgcgcatccgtcgcctgatcctcaccgcgtcgggcgggccgttc
cgagggcgccagcgcgaagaccttgcccacgttacccgcgaacaggccctgaaacacccc
aactggtcgatgggggccaagatcaccatcgacagtgcctctctggccaataaggggctg
gagctgatcgaggcggcctatctgtttgacatgccgtccgctcagattgacgtcctgatc
catccgcaatccgtggtgcacagccttgtcgaatatagcgacggctcgaccctggctcag
atggggccgccggatatgcgggtgccgatttcctactgcctcggctggccgcagcgccat
agctggtccgcgccgccgcttgatctgtgcgcgctttcgaccctgacgtttgagcggccc
gataccgaggccttccctatgctcaggctggcgcgtgaggcgctggaagccggcgggctg
atgccggtcgtctataatgccgccaacgaggtgatggtgcaggccttccttgaggggcgc
atcggattcctcgacattccggcaacggtcgaagccgccatgatgagggcgcaatcgctg
tctatggctttcggtaatgatttgcgccatgatgtcgagtgcatcgagcaggcggatgcc
gaaacgcgggcgcaactggccgtttctggtgaggcagcccattggacagcgggaacacag
gggcaggccttttcgcgggcctga

DBGET integrated database retrieval system