KEGG   Asticcacaulis excentricus: Astex_2897Help
Entry
Astex_2897        CDS       T01378                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00010  Glycolysis / Gluconeogenesis
aex00051  Fructose and mannose metabolism
aex00562  Inositol phosphate metabolism
aex01100  Metabolic pathways
aex01110  Biosynthesis of secondary metabolites
aex01120  Microbial metabolism in diverse environments
aex01130  Biosynthesis of antibiotics
aex01200  Carbon metabolism
aex01230  Biosynthesis of amino acids
Module
aex_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Astex_2897
   00051 Fructose and mannose metabolism
    Astex_2897
   00562 Inositol phosphate metabolism
    Astex_2897
Enzymes [BR:aex01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Astex_2897
Exosome [BR:aex04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Astex_2897
  Exosomal proteins of bladder cancer cells
   Astex_2897
  Exosomal proteins of melanoma cells
   Astex_2897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU14534
JGI: Astex_2897
UniProt: E8RSR3
Position
2:complement(582877..583629)
Genome map
AA seq 250 aa AA seqDB search
MPKHPLIAGNWKMHGLRDAIPEALAMDTAARQSRASVAIFPPSTLLFALSEALNARPEPS
PVRLGGQDCHKDAQGAFTGDLSAEMLKDAGAEMVILGHSERRHGHKEACESVAAKTLAAL
RAGLEPIICIGETLDQRQEGLTHAVLSKQLRDSLPLALEGQTFHVAYEPVWAIGTGHVPT
DDQVIDAMLLIQKHLAQRFHNQVVPHTLYGGSVKPDNARHLLSLDGVDGLLVGGASLKAE
DFNRIIAAAD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacatccgcttatcgcgggcaactggaagatgcatggcctcagggacgccatt
ccggaagccctggccatggataccgccgcacgccaaagccgtgcttcggtcgccatcttc
ccgccgtccacacttctctttgccctgagtgaagccctgaacgcccgtcctgaacccagc
ccagtgcgtctgggtggtcaggactgtcacaaagacgcccaaggtgcgtttactggcgat
ctgtcggccgaaatgctgaaagacgccggggccgaaatggtcatattgggccattccgaa
cgccgtcatggccacaaggaggcctgtgaaagcgtggccgccaagacgctggcggcacta
cgggccgggctggagccgattatctgcatcggggaaacgctcgatcagcgtcaggagggc
ctgacccacgctgtgctcagcaagcagttgcgtgacagcctgcctctggcgctggaaggg
caaaccttccatgtcgcctatgagcctgtctgggccatcggcaccggccacgtgcctacc
gatgatcaggtcatcgacgccatgctgctgattcagaagcatctggcgcagcgtttccac
aatcaggtcgtgccgcacacgctttatggcggctcggtcaagccggacaatgcccgccac
ctgttgtcgcttgacggcgtggatggcctgctggtcggcggtgcatcgcttaaggctgag
gatttcaaccgcatcatcgccgccgcggactga

DBGET integrated database retrieval system