KEGG   Asticcacaulis excentricus: Astex_2949Help
Entry
Astex_2949        CDS       T01378                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
aex  Asticcacaulis excentricus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Astex_2949
Enzymes [BR:aex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Astex_2949
Exosome [BR:aex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Astex_2949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:632108..633109
Genome map
AA seq 333 aa AA seqDB search
MTFSPLVGAYPLARPRRLRQSGWVRDLVAEHHLSVSDLIWPIFVHDKDVARDPIRSLEGV
DRLSITEAVKEAREAHALGIPALALFPNIDPSLRNDDATAAYDPDGLIARTCRAIKSAVP
EMGLIVDVALDPFTSHGHDGILSDGRIHNERTIEILTRQALVQAEAGADVLAPSDMMDGR
IGEIRKALEAQGLTDKLILSYAAKYASAFYGPFRDAVGTSALKGDKKTYQMDSANTDEAL
REVAMDLQEGADMVMVKPGLPYLDIVQRVSETFKVPTFVYQVSGEYAMIKAAVNAGFMDH
DKGVFETLLAFKRAGASGVLTYFAKYVAEKLKG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaccttctcccctctcgtcggtgcctaccctctggcccgcccgcgccgtctgcgtcag
tcgggctgggtgcgtgatctggtggccgaacaccacctcagcgtttctgacctgatctgg
ccgatcttcgtgcacgacaaagacgtggcgcgtgaccccatccgctcactggaaggcgtc
gatcggctgagcattaccgaggcggtgaaggaagccagagaagcccacgcgctgggcata
ccggccttggcgctgtttcccaatattgacccgtcgctgcgcaacgatgacgcgacagcg
gcctatgaccccgacggcctgatcgcccgcacctgccgcgccatcaaatcggccgtgccg
gaaatgggcctgatcgtcgatgtggcgcttgatcccttcacctcgcacggccacgacggc
atcctcagcgacggcaggattcacaacgaaaggaccatcgagattctcactcggcaggcg
ctggtgcaggccgaagccggggcagatgtcctcgccccctccgacatgatggacgggcga
atcggcgagattcgcaaggcgctggaggcacagggcctgaccgataagctgatcctgtcc
tacgccgccaaatacgcctcggccttctatggcccgttccgcgacgcggtcggcacctcg
gcgctgaaaggtgacaagaagacctatcagatggacagcgccaataccgacgaggccttg
cgcgaagtcgccatggaccttcaggaaggcgccgatatggtgatggtcaagcccggcctg
ccctatctcgacatcgtgcagcgcgtatcggaaacgttcaaggtgccgaccttcgtctat
caggtgtcaggcgaatacgcgatgatcaaggcggcggtgaatgccggcttcatggaccac
gacaagggcgtgttcgagacgctgctggccttcaaacgcgccggcgcgtcgggcgtgctg
acctattttgccaagtacgtggcggagaagcttaaggggtag

DBGET integrated database retrieval system