KEGG   Asticcacaulis excentricus: Astex_2969Help
Entry
Astex_2969        CDS       T01378                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
aex  Asticcacaulis excentricus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Astex_2969
Enzymes [BR:aex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Astex_2969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(650916..651467)
Genome map
AA seq 183 aa AA seqDB search
MSKTVAALSANVPDIYIAYGANLPHEYLNPLQALERVVKRLCLDDIKVTQISSLWCSQAW
PDPNYPPYHNAVMAVCTTLKPDDLLTQLHALEAETGRVRSEKSNLPRVLDLDLIAYGDRV
REGVLVLPHPRAHERGFVMGPLAEIAPDWRHPVLGVSARELYARVTVGTDAYPAEDTSAL
LSL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaacagtagcagcgttatcggcgaatgtgcctgacatctacattgcctatggc
gcgaatttgcctcacgaatatctcaatcctttgcaggccttggagagggttgtcaagcgc
ttgtgccttgatgacataaaggttacgcagatttcatccctctggtgctctcaggcgtgg
ccggaccctaactatccgccttaccataacgccgtaatggcggtttgcacgactctgaaa
ccggacgatttacttacgcagttacacgcgctggaggccgaaaccggtcgcgtgcgaagc
gaaaaaagcaatctaccgcgcgtgctcgatctcgatctgatcgcctatggcgacagggtg
cgtgagggcgtgctggtcctgccgcatccgcgtgcccatgagcggggttttgttatgggg
ccgctggcggagattgcgccggactggcggcatccggttttgggcgtaagcgcgcgggaa
ttgtacgcgcgggtgacggtagggaccgatgcctatccggcggaagatacgtccgccttg
ttaagcctctga

DBGET integrated database retrieval system