KEGG   Asticcacaulis excentricus: Astex_3092Help
Entry
Astex_3092        CDS       T01378                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aex  Asticcacaulis excentricus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Astex_3092
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Astex_3092
Enzymes [BR:aex01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Astex_3092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:789994..790536
Genome map
AA seq 180 aa AA seqDB search
MGALHDIPLKRIDGTETSLGDYAGKVLLVVNVASKCGLTPQYEALEALYRDKHAQGLEIL
GFPANNFMGQEPGTDQEIASFCQTAFDVSFPLFSKISVAGPDKHPLYAALTEAWPDAAGA
ELMREKFAGYGFPPTPRGEILWNFEKFVVGREGKVVARFSPDVAPDDVRLIDALNKALAA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcactgcacgatatcccgctgaagcggattgatgggactgaaacgtcgctgggt
gactatgccggtaaggtgttgctggttgtcaatgtcgcctcgaaatgcggcctgacccct
cagtatgaggcgctggaggctctctatcgcgacaaacacgcgcagggtctggaaatcctc
ggttttcccgccaacaacttcatgggacaggagcccggtacagatcaggagatcgccagt
ttctgccagaccgcgtttgacgtgtcctttcccctcttctccaagatcagtgtcgccggg
ccggacaaacatccgctctatgcggccctcaccgaagcctggcccgacgccgccggggct
gagctgatgcgcgaaaagtttgccggttatggcttccccccgaccccgcgcggcgaaatc
ctctggaatttcgaaaagttcgtcgtcggccgcgagggcaaggtcgtggcgcgcttctca
ccagacgtcgccccggacgatgtgcgcctgatcgacgccctcaacaaggcgctggcggct
taa

DBGET integrated database retrieval system