KEGG   Asticcacaulis excentricus: Astex_3139Help
Entry
Astex_3139        CDS       T01378                                 

Definition
protein-l-isoaspartate(d-aspartate) o-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aex  Asticcacaulis excentricus
Brite
Enzymes [BR:aex01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Astex_3139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(843922..844551)
Genome map
AA seq 209 aa AA seqDB search
MDYFAARQNMVESQVRVNDVTDPALQKAMRHIERERLVAPGQGFAAYGDVEPQIAPGRAL
MLPRDLAKLLHGLKPVAGQKVLAIGAPYAAAVLKHAGLDVTVQEADARVQTVVEPYLKAL
GISLVVQDLKTPVAGEYDIIVSEGAVEEVPAEWFAALKLHGRLGVVVRSGALGEARVYTR
LQAGVSEAFVFNAATAVLPGFTKAPAFVF
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggattacttcgccgcccgtcagaacatggttgaatctcaggtgcgggtgaacgacgtc
accgatcccgcgctgcaaaaggccatgcgtcatattgagcgcgagcgtctggtcgcgccg
gggcagggctttgccgcctatggtgatgttgagccgcagatcgcgccgggccgcgccctg
atgctgccgcgcgacctcgccaagctgttgcacgggcttaagcccgtcgccggtcaaaag
gtgctggccatcggcgcgccctatgccgccgctgtgctcaagcacgccggtctcgatgtc
acggttcaggaagccgatgcccgcgttcagaccgtggtcgaaccctatctgaaggcgctg
ggcatctctctggtggtgcaggacctcaagacccccgtcgccggtgaatacgacatcatc
gtcagcgaaggtgcggttgaggaagtccctgccgaatggttcgccgcgctgaaactgcat
ggccgcctgggtgtggtggtgcgcagcggcgctttgggcgaggctcgtgtctatacccgc
cttcaggctggtgtgtccgaagcctttgtgtttaatgcggcgaccgccgtgctgcccggc
ttcaccaaggccccggccttcgtgttttaa

DBGET integrated database retrieval system