KEGG   Asticcacaulis excentricus: Astex_3207Help
Entry
Astex_3207        CDS       T01378                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
aex  Asticcacaulis excentricus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aex00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aex00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aex00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:914539..917406
Genome map
AA seq 955 aa AA seqDB search
MLDRRDLLKSVSLLGAVSYGVPARANATDRVAPSPDPEVASGPSPREVLSLNKGWRFFEG
DIPFPKILGHGWSYANAKAGSAWGAAAASYDDTEWDSVTLPHDFASFQVPNELENLAQGY
RKRGIGWYRNLLKFEESDRGKHIELQLDGISTHATIWLNGTLINRNWSGYNSICVDITPY
LSYGSALNSLVVRVDADAMQGWWYEGAGIYRNTWIVKRHPLHIETDGVFAHPVKTGDQWQ
IPIEVTLNNTTDRPQSAEIVSSLVDAAGRVVSTCRLTAQLPPMQTGVVTGRMSVQYPTLW
DIDSPYLYQVRTQLIQQGHVLDEVVTPAGFRTQSFDPDKGFFLNGRPVKLKGVCIHQDHA
GVGVAVPVGLLEYRLHRLKDLGCNAIRCSHNAQDKAFYALCDRMGLLVMDENRVFNPSPI
HMAELEWLVRRDRNHPSVILWSVFNEEPMQGTEQGYQMVRRMVAKVKALDTTRPVTAAMN
DGLFTPVNVSQAVDVVGFNYQYQNYDAFHKAHPTLPITSSEDCSAFMTRGEYKTIKDKHI
IASYDDDAADWGTTQRVGWKAIAERPFVAGTFVWTGFDYHGEPTPHQWPSNSSFFGIMDL
CGFAKTAFWMRQAMWCSEPVLHLAPHWNWAGQEGQDILLMALHNMDEVELFLNGRSLGRQ
TGDRYEMNRWSVAYAPGKLSAVGYRGGKVVKRFEVETTGAPVQLKLTPFRPLMKGDGIDA
QPFTVEALDAKGRHVPTAQHSVRFTVEGGDIIGLGNGNPNDINREKGDTRALFNGLAQVI
VQTREGQSGPLVLKAMAEGLKTATLRIDVQAAQPWPYQAVSKSVQITENWRRAPEQAGPL
EPHLRPKDNDMNSWGWFRAGVPFPAPDRDTEVLCAVEVEPYAKVRKSGGVIECLGLLGPA
TLYIDGQKVAEKASDDSAPLSAPFPKGAGKHWVSLIFRARGGQPFGFTDVVRIRA
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
gtgctagacagacgtgacttgttgaaatccgtgagcctgctgggggccgtgtcctatggg
gtccccgcacgggcaaatgcaactgatcgtgtcgccccttctccggatccggaggtcgcc
agcgggccgtcaccgcgcgaagtgctctcgctgaacaagggctggcgttttttcgaaggc
gacatccccttccccaagatattggggcacggctggtcctacgccaatgccaaggccggt
tcggcctggggcgcggcagcggcttcatacgacgatacggagtgggacagcgtcacgcta
ccccacgactttgccagttttcaggtgccgaacgaactcgaaaatctggcgcagggttat
cgcaagcgcggcattggctggtatcgcaacctactgaaattcgaggagagcgaccgcggc
aagcatatcgagctacaactggatggcatctcgacccatgccaccatctggctcaatggc
acactgatcaaccgcaactggtcgggctacaattccatctgtgtcgatatcacgccctat
ctgtcctatggttcggcgctcaattcgctagtagtgcgcgtcgatgccgacgccatgcag
ggctggtggtacgaaggggcgggcatttaccgcaatacttggatcgtcaagcgtcatccg
ctgcatattgagaccgatggcgtgtttgcccaccccgttaagaccggtgatcagtggcaa
attcccatcgaagtgacgctaaacaacaccaccgaccggccgcaatcggcggagatcgtc
tcatcgctggtcgatgcggcgggccgtgtcgtcagcacttgtcgcctgaccgcgcaactc
ccgcctatgcagaccggcgttgtgaccggtcgcatgagcgtacagtacccgaccctgtgg
gatatcgactccccctacctgtatcaggtgcgcacccaactcatccagcaagggcatgtc
ctcgacgaggtggtgacccccgccgggttccgaacccaaagctttgacccggacaaggga
ttcttcctcaatggccggcccgtcaagctgaagggcgtgtgcatccatcaggaccatgct
ggggtgggcgtcgccgtgcccgtcggacttctggaataccgcctgcaccgcctcaaagat
ctgggctgcaacgccatccgctgctcgcacaatgcacaggacaaggctttttacgccctg
tgcgatcggatgggccttctggtgatggacgaaaaccgcgtcttcaacccctcgcccatc
catatggccgaattggagtggctggtgcgccgcgatcgcaaccatccctctgtcatcttg
tggtccgtcttcaacgaagaaccgatgcagggcacggaacagggctatcagatggtccgg
cgcatggtggcgaaggtcaaggcgctcgacaccacccgaccggtgacggcggccatgaat
gacggcctgtttacgcccgtcaatgtgtctcaggccgtcgatgtggtcggtttcaactat
cagtatcagaattacgacgccttccataaggcgcacccgaccctgcccatcacctcgtcg
gaagactgctccgcctttatgacgcgcggggaatacaagacgataaaagacaagcatatc
atcgcctcctatgacgatgacgccgcagactggggcaccacgcagcgcgtcggctggaag
gccattgccgagcggccttttgtggcaggcacctttgtgtggaccggcttcgattatcac
ggcgaaccgacaccgcatcagtggccttccaactcgtccttcttcggcattatggacctg
tgcggcttcgccaagaccgccttctggatgcggcaggccatgtggtgcagcgagccggtg
ctacatctggccccgcactggaactgggccggacaggaggggcaggacatcctcctcatg
gccctgcacaatatggacgaggtggaactgttcctgaatggccgctcgctggggcgtcag
acgggggaccgctatgagatgaaccgctggagcgtcgcctatgcgcccggaaagctgagc
gccgtcggctatcgcggcggcaaggtggtcaagcgctttgaggtcgaaacgaccggcgcg
ccggtgcaactgaaactgacgcccttccgtccgctgatgaagggggacggcatagatgcc
cagcccttcacggtcgaagcgctggacgcgaagggccggcacgtgccgacggcgcagcac
agcgtgcgctttacggtcgaaggcggtgacattatcgggctcggcaacggcaatcccaac
gacatcaaccgcgaaaaaggcgacacgcgcgccctgttcaatgggctggcgcaggtgatc
gtccagacgcgcgaaggccagtccggcccgctcgtcctgaaggccatggccgagggactg
aagaccgcgacgctcaggatcgacgttcaagcggcgcagccctggccctatcaggccgtc
tccaaaagcgtgcagatcaccgaaaactggcggcgcgcccccgaacaggcgggccccctt
gagccccatctgcgccccaaggataacgacatgaattcgtggggctggttccgcgcgggc
gtgcccttccccgcgcccgaccgcgacacggaggtcctgtgcgccgtcgaggtcgaaccc
tatgccaaggtgcgcaagagcggcggcgtcatcgaatgtctgggcctgctgggcccggcc
accctctatatcgacgggcagaaggtggccgaaaaggccagcgacgacagcgcccctctg
agtgcccccttccccaagggcgccgggaagcactgggtcagtctgattttccgcgcccgt
ggcggccagcccttcggctttaccgatgtggtgcgtatccgcgcctga

DBGET integrated database retrieval system