KEGG   Asticcacaulis excentricus: Astex_3219Help
Entry
Astex_3219        CDS       T01378                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Astex_3219
Enzymes [BR:aex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Astex_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Cellulase Glyco_hydro_14 LBP_M DUF4148 ThuA DUF4159 DUF2194 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: ADU14854
JGI: Astex_3219
UniProt: E8RTN3
Position
2:complement(936091..938139)
Genome map
AA seq 682 aa AA seqDB search
MKLKATLVGACALLSAVTSASFAQAPAGQLRVPDSHLYVGANYQPVDRTPAQIHQDIARM
KAAGFTVVRMGDLSWDYFQPAEGVFTFEAFDAVLEEMHRNGIKVIVDIPGQPAPMWLHKA
YPGVDLVTQNGTRLYAAERYMDNTSDPDYLRLVAALAEAMTKRYGHHPAVIAFGYNNEIG
NGFMSYSEADKTRFVAWLQKKYGSLDTLNKAWATQRWSRTLTAWDQVEIPYGDGPGPFER
YLDLRRYWSEATINVLMILENARRKNAPDKPVISNLWDSSDRKGFDYLSTYKQYVSHGSH
GYYNGDAISGAFETLMMRGALPTPSWFSEFQAGGGGYYGSKGRSRMWGYFGLLNGAQGML
AWTFNTHLGGEEQALFGLIDHDDTPSWKLDEWATMAKEFKTLEKLGFPRELKPQVAFAYS
FEAKTASSPKSWSNTVAQYLTTPYMVHAHNAFSPVYNDNIDVAVINVGKEDLSRYKMVVV
PGLYLMDKASADNIRHYVRDGGTVIMTAMSAKVNETNQWFNTPLPGYLSDVFGVKTREFY
RRDAALTGQIGAASVNTTIHFYEVLEPTTATVLGRFSNVEGTPPLATINSYGKGQAIYVA
TPAQPSVLQPLYRSLYGRLGITPGPATPEGVYARVVDGRTLYVNASYGPKDIRIEGTKTG
LLSGKTWSGTLHLEADGVDIVQ
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaaagcgaccttggtgggggcgtgcgccctgttatcggcggtgaccagcgcc
tctttcgcgcaggctccggcagggcagctgcgcgtgcccgactcgcatctctatgtcggt
gccaactatcagccggtggaccgcacgcccgcgcagattcatcaggatattgcgcgcatg
aaggccgccggtttcaccgtggtgcgcatgggcgatctgtcgtgggattacttccagccc
gctgagggcgtcttcacctttgaggcctttgatgcggtgctggaggagatgcatcgcaac
ggcatcaaggtgattgtggatattccgggccagccggcccccatgtggctgcataaggcc
tatccgggcgtggaccttgttacgcagaacggcacacgcctctatgccgccgaacgctat
atggataataccagcgaccctgattatctgaggctggtcgccgcattggccgaggccatg
accaaacgttatggccaccatccggcggtcattgccttcggctacaataacgaaatcggc
aatggcttcatgtcctattccgaggcggacaagacccggtttgtggcgtggctgcaaaag
aagtacggctctctggacactctgaacaaggcctgggcgacgcagcgctggtcgcgcaca
ctcactgcctgggatcaggtggaaatcccttatggggatgggccgggcccttttgagcgc
tatctggatctgcgccgctactggtcagaagcgaccatcaacgtcctgatgatcctcgaa
aacgcccggcgtaaaaacgcgccggacaagccggtcatttccaacctgtgggacagcagc
gaccgcaaggggttcgactacctgtccacctacaagcagtacgtgtcgcacggctcgcac
ggctattataacggcgatgccatcagtggtgccttcgaaaccctgatgatgcgcggcgcc
ttgccgacaccgagctggttttccgagtttcaggcgggtggcggcggttattacggcagc
aaaggccgatcgcgcatgtggggctatttcggcctgctgaacggggcgcagggcatgctg
gcctggacgttcaatacgcatctgggcggcgaggagcaggctttgtttggcctgattgat
cacgatgacaccccgtcgtggaagctggacgaatgggccacgatggccaaagagttcaaa
acgcttgaaaaactcggcttcccccgcgaactgaagccacaggtcgccttcgcctattct
ttcgaggccaagaccgcttcaagccccaaaagttggtcgaataccgtcgcccagtacctg
accacgccctatatggttcacgcgcacaatgccttttcgcccgtctataacgacaatatc
gacgtcgcggtgatcaatgtcggcaaggaggacctcagccgctacaagatggtcgtggtg
ccgggcctctacctgatggacaaggcgtcagcggacaatatccgccactatgtgagggac
ggcggcacggtcatcatgaccgcgatgtccgccaaggtgaacgagacaaaccaatggttt
aatacgcctttaccgggctatctgtcagacgtcttcggggtgaagacacgcgaattttac
cgcagggacgccgctttgaccgggcagatcggggccgcgtcggtcaacaccaccattcac
ttctatgaggtgctggaaccgaccaccgccacggttctgggccgtttttccaatgtcgag
ggaacgcccccgctggctacgatcaatagctacggaaaggggcaggccatctatgtcgca
acgcccgctcagccgtcggtgctgcaacccttataccgcagcctctatggccgtttgggg
atcacgccggggcccgcgactcctgagggcgtctatgcgcgggtggtggacggccgcacc
ttgtatgtgaacgcctcctacggtccgaaagatatccgtattgaaggcacgaaaacgggg
ttactttccgggaagacgtggtcggggactctacatctggaggccgacggcgttgatatt
gtgcaatag

DBGET integrated database retrieval system