KEGG   Asticcacaulis excentricus: Astex_3283Help
Entry
Astex_3283        CDS       T01378                                 

Definition
cytochrome c class i
Orthology
K08738  
cytochrome c
Organism
aex  Asticcacaulis excentricus
Pathway
Sulfur metabolism
Metabolic pathways
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:aex00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:aex02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1014772..1015149
Genome map
AA seq 125 aa AA seqDB search
MTHILKGLTPLTGTLLLIVSLTPAQAQDAAAGKKAFGACLSCHSVKPGATGIGPSLAGIV
GKKAGTNDPKFSYSAAMKKGPVWSEAQLDRFLADPKGTLPGNTMAMAPTKDAKKRADIIA
YLKSN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgacccatattttgaaaggcctgacgccactgactggcactttgctactgatcgtgtcc
ctcaccccggcgcaggcgcaggacgcggctgccggtaaaaaggccttcggggcctgcttg
tcctgccattcggtgaagccgggtgccacgggcatcggcccgtcactggctggtattgtc
ggcaagaaggccgggaccaatgatcctaagttcagctactcagccgcgatgaagaagggg
ccggtatggagcgaggcgcaactggaccgctttctggccgatccgaaaggaaccctcccc
ggcaacaccatggccatggccccaacaaaggatgccaaaaagcgcgctgatatcatagcc
tatctcaaatccaattag

DBGET integrated database retrieval system