KEGG   Asticcacaulis excentricus: Astex_3294Help
Entry
Astex_3294        CDS       T01378                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
aex  Asticcacaulis excentricus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Astex_3294
   00052 Galactose metabolism
    Astex_3294
Enzymes [BR:aex01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Astex_3294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1025596..1026741)
Genome map
AA seq 381 aa AA seqDB search
MRALILLPLVASSLMLSSLSRPQVSHVPFGVTAGGEAVERYTLRNRRGTEVSVLTYGAIL
DAVRVRDRRGRLDNVVLDLIDLKAHEARANFSAVVGRFANRISGGGFTLDGRRVVLDPKG
GIVSHGGRPGFSGRVWIAEPCATRGCRSLTLRYISPDGENGFPGTLRVSVTYSLSDDDTL
TLDYRATTDKPTVINLTNHAYFNLGGAASGSTDAQYLQLKADAITALSDKKLPTGALRPV
VGTPFDFRRPAQIGAQIVRADPQLKIGGGFDHNFVLSKPQPGALSVAARAWDPKSGRTLE
LKTTEPGVQLFTGNGFNGTLNGRAGNRIWPRDGFALETQHFPDSPNRPEFPSTVLRPGEV
FHSVTTIRFGTAKTLKEAFSD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccctgatccttctgccgcttgtggcttcgtctctgatgctgtccagcctgtcc
cggccacaggtcagccatgtgccgtttggggtgacggccggtggtgaggcggtggaacgc
tacaccctgcgtaaccgacgcggaacggaggtgtcggttctgacctatggggccattctc
gatgcggtgcgggtgcgcgaccggcgcgggcgtttggacaatgtggtgcttgatctgatt
gacctaaaggcgcatgaggcgcgggccaatttcagcgccgtggtcggccgctttgccaat
cgcatatcgggcggcggttttacgctggacgggcggcgcgtggtgctcgaccccaagggc
gggatcgtttcacatggcggcaggcccggcttttccgggcgcgtgtggattgctgagccg
tgcgcgacgcggggctgccgctcgctgaccttgcgctacatcagcccggatggcgagaac
ggttttccggggacgttgcgtgtttcggtgacctatagcctgtcggatgacgacacgctg
acgctggactaccgcgccacgaccgacaagccgacggtgatcaacctgaccaaccacgcc
tatttcaatctgggcggggcggcgtcgggttcgaccgacgctcagtacctgcaactgaag
gccgacgccattaccgccctgtcggacaagaagctgccgacaggggctctgcgcccggtc
gtgggcacaccgttcgatttccgtcgcccagctcagattggtgcgcagatcgtcagggcc
gatccgcaattgaagatcggcggcggcttcgaccataattttgtgctgagcaaaccccaa
cccggcgcgctgagcgtggcggcgcgggcctgggacccgaaaagtggccggactctggaa
ctgaagaccaccgagccgggtgtgcagcttttcaccggcaacggctttaacggcacgctg
aatgggcgggcgggcaatcgcatctggccccgcgacggtttcgcgctggaaacccaacat
tttccagacagcccaaatcgcccggagtttccttcgaccgtgctgcggccgggcgaggtc
ttccattcggtgacgacgatccggttcggtacggcgaagacgctgaaagaggccttctca
gattaa

DBGET integrated database retrieval system