KEGG   Asticcacaulis excentricus: Astex_3354Help
Entry
Astex_3354        CDS       T01378                                 

Definition
beta-n-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aex  Asticcacaulis excentricus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Astex_3354
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Astex_3354
Enzymes [BR:aex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Astex_3354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1108110..1110701)
Genome map
AA seq 863 aa AA seqDB search
MTLAHSVSLSTLALVLSLTAGCAALPQTPVSAPAAPSVAPPLPSLDQATLDRLGDHLGYR
WEIVDNRQTCDKAACFLSALTLTLPEGGELPGGWTLYFSYVGAFVRSESDAFDLKQVNGD
LYALTPKGGVALKGGASHTVRVWGQGHFYARGFMMPNAYVAAPALTPRTIRASKVAIDRE
SGLETLPFVAPMTDEAKLGSQTPGDKTQWLTPQRAYERNASHNVALTRPAVVILPTPAKV
TLQKGAPLDLSKGFDLRLKGLGRDAITAAVKALKQAGAGEGRGPVLSVTIDPKLSPEAYR
LAVGKSVTIRAGSTTGANHALRSLAQQTAFDGAQVRRMTIEDAPRLPFRGLHIDVARNFH
SKVFVLETLEQMAAYKLNRLHLHLGDDEGWRLEIEGLPELTQVGAYRCHDLAEETCLLPQ
LGAGPERDTPVNGYFTKADYIDILRAAQARGIEVIPSFDMPGHSRAAIKSMEVRYRRLMA
AGDAAGAAQYRLVEPGDTTAYRSIQHYNDNTLNVCLPATYAFIDKVIDETMKLHQAAGVP
LKRYHIGADETAGAWTQSPACQAFMAQNGLKAPQLTPYFIERVSAYLAEKGIETAGWSDG
MGHTDAARMPKVVQSNIWSATLGAAATEAHDQANRGWEVVLSVPDVTYFDMPPAPDPDET
AYDWASRDTDSYKIFSFQPENLPANASLLTDIRGQGATVADKTPYAPGRGLTGIQGQLWS
EVVRTDDEAEYRLFPRLLPLAERAWHRAGWEAPYKAGESYTYGDGKVDPKAVLGDWQGFR
DRLGVHLRLLDQAGIAYRLAPPGAKIEGGQLFANAEIAATPIEYRLTGDEWTPYTGPVAV
SGPVELRVTSPDGRRKSRIVTVK
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgaccttagcccattctgtcagcctgagcacactggcccttgtcctgtccctgaccgcc
ggttgcgccgccctgccgcaaacgccggtatcagcgcccgctgcgccaagtgtcgccccg
cccctgccatcgctggatcaggccacactggaccgtctgggcgatcacctcggctatcgc
tgggagatcgtcgataaccgtcagacctgtgacaaggcggcttgtttcctgtcggccctg
accctcacccttcccgaagggggcgagctgcccggcggctggaccctctatttctcctat
gtcggcgcgtttgtgcgctctgaaagcgacgccttcgacctgaaacaggtcaatggcgac
ctctacgccctgacacccaagggcggcgtcgcgctgaaaggtggcgcttctcatacggtt
cgagtctgggggcaggggcacttctatgcgcgcggtttcatgatgcccaacgcctatgtg
gccgcgcctgcactcaccccccgcaccattagggcctcgaaggtggcaatcgaccgcgaa
agcggtctggagaccctgccgtttgtcgcaccgatgaccgatgaggcgaagctgggcagc
cagaccccaggcgacaagacgcaatggctgacgccgcaacgcgcctatgaacgcaatgcg
tcacacaatgtggccctgacccgtccggccgtggtgatcctgccaaccccggccaaggtg
accctgcaaaagggcgcgccgctcgatctcagcaaggggtttgacctgcgcctgaagggc
ctgggccgcgatgccattaccgccgccgtaaaggcccttaaacaggctggggccggtgag
gggcgggggcctgtgctcagcgtcactatcgacccgaaactgagccccgaagcctaccgc
ctggcggtgggcaaaagcgtcaccatccgcgcgggatcaacgaccggtgccaaccacgcc
ctgcgctctctggcccagcaaacggcctttgatggcgctcaggtgcggcgtatgaccatc
gaagacgcgccacgcctgcccttccgcggcctgcatatcgacgtggcgcgcaacttccat
tccaaagtctttgtgctcgagacgctggagcagatggcggcctataagctcaaccgcctg
cacctgcatctgggcgacgacgaaggctggcggctggaaatcgaaggcctgccggaactg
acgcaggtgggggcctatcgctgccacgacctggccgaagagacctgccttctgccgcag
ctgggtgccggaccggagcgcgacacgccggtcaatggctatttcacgaaggctgactat
atcgacatcctcagggcggcgcaggcgcgtggcatagaggtcatcccctccttcgacatg
ccgggccacagccgcgcggcgatcaaatccatggaggtccgctatcgccgtctgatggcc
gccggtgatgcggcgggggcggcgcaatatcggctggtcgaaccgggagacaccacggcc
taccgctcgatccagcattacaacgacaacacactcaatgtctgcctgcccgccacctat
gccttcatcgacaaggtcatcgacgagacgatgaagctgcatcaggccgccggtgtgccg
ctgaaacgctaccatatcggggcggacgagacggccggggcgtggacgcaatcgcccgcc
tgtcaggcctttatggcgcagaacggcctgaaagcgccgcaactcaccccctatttcatc
gagcgcgtctcggcctatctggccgaaaaaggcatcgagacggcgggctggagcgacggc
atgggtcatacggacgctgcgcggatgccaaaggtcgtacagtcgaacatctggagcgcc
acgcttggggccgcagccaccgaagcgcacgatcaggccaatcgcggctgggaagtcgtg
ctgtccgtgcccgatgtcacctattttgacatgccgcccgccccggacccggacgagacg
gcctatgactgggcgtcgcgcgatacggacagctacaagattttcagcttccagccggaa
aacctgccggccaatgcctcgctgctgacggatatacgcgggcagggggcgacggtggcc
gacaagacgccctatgcgccggggcgcggcctgaccgggatacaggggcagttgtggtca
gaggtggtgcgcaccgacgacgaggccgaataccgcctcttcccgcgccttctgccgctg
gccgaacgcgcctggcaccgggcgggctgggaagcgccgtataaggcgggtgagagctac
acctatggcgacggcaaggtcgaccccaaagccgtgctgggcgactggcagggcttccgc
gaccggctgggggtgcatctgcggcttctcgatcaggcgggcattgcctatcgtctggca
ccgccgggggcgaagatcgaaggcgggcagttgttcgccaatgccgaaatcgctgccacc
cccatcgaataccgtctcacgggggacgaatggacgccctatacggggccggtggcggtg
agcgggccggtcgaactgcgcgtcacctcgcccgatggccgccgcaagagccgcatagtg
acggtgaagtag

DBGET integrated database retrieval system