KEGG   Asticcacaulis excentricus: Astex_3400Help
Entry
Astex_3400        CDS       T01378                                 

Definition
(GenBank) glycoside hydrolase family 2 TIM barrel
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
aex  Asticcacaulis excentricus
Pathway
aex00052  Galactose metabolism
aex00511  Other glycan degradation
aex00600  Sphingolipid metabolism
aex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Astex_3400
  Lipid metabolism
   00600 Sphingolipid metabolism
    Astex_3400
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Astex_3400
Enzymes [BR:aex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Astex_3400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2 Bac_rhamnosid_N BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: ADU15033
JGI: Astex_3400
UniProt: E8RU62
Position
2:1167921..1171103
Genome map
AA seq 1060 aa AA seqDB search
MVSKVGARRVLCAVSVSCLALLAASGGQAQTATELKAIADAPPPDVSGRAEWEQPEVLAV
NRLPMKATFFNYESVEKAVAGQIAASANYLSLDGTWKFALSKTPETRPVDFYKPDFDVSD
WGTVQVPGILQAQGYGVPLFSGAGYPFGANEPYVRHEVNEIGSYRRDFELPNWSGKDVFL
HIGAAGAAYYIWVNGQKVGYSEDSKLPSEFDLTPYVRTGENTISIELYRYADGSYLEDQD
FWRLSGIERSVYLYAEPKTRLGDYTVTALLDKAYSDGVFALEAELKGVKGEGTITATLYD
GETVVLAARGRATSDKPARLSGTIKNVRQWSAETPNLYRMVIEYRDIKGALVSATAKKIG
FRTIEIRNGEVQVNGKRVMIKGVNRHEHDPHTFRVVSPETTRRDMELMKQAHVNALRMSH
YPNDPHVYDLADEYGLYVMDEANIESHTYMAMIRDINQRYKAQLGYKPHWYAAHLDRVSR
MVERDKNVTSVVFWSLGNEAGIGPAFERAAKWVRDHDKTRLLNFLGHGTIGEEHRPNAYV
DIYAPMYDSPVKMADYAKDSRYNQPMIQCEYAHAMGNSLGNLEDYWETIRAYKKLQGGFI
WDWVDQAVIRKDAKGRDYWAQGFDFPTGEWQEDSTIGDGVVQADRTPDPEYYELQKVYSP
VVFEGDPKAGTLTVVNRNDIIDLSGYAFGWKLEKDGLTVKTGTLMGVNAPAAGRAAVPLD
LGAVSYDPAAEYVLTVSAVAADDRMPGLPKGASMGWTQFVLQTPRPAALTASGPVKVTRT
ASAVELSAGRSRLTLDAKTGLLSAYVVNGQLLLSGGMPYFWRGPTDNDIGTGVVTSHAIW
KTLSEKRTLETLDVSDAGEVKVGWRVGAGSVRFTTTWHLYGDGTLNVKADYVPLRDDLPD
PLRVGLRFATSPALTDLQWYGRGPQESYADRKTGAAIGLYQGKVADQYHNYVRPQESGNK
TDVRWMTLTTATGQGVRVTGHQPLSANALAFPVEDLYQQPVGQRHSSDITPRGDGTLMID
LLQTGVGGDTGWNTVGRPHVKYRIPNAPLSYGFTLSPLGQ
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcaaggtgggggcgcgccgcgtcctgtgtgcggtatcggtttcgtgtctggcg
ctgctggccgcaagcggcgggcaggcgcagacggcgacggagctgaaggccatagccgat
gccccgccgcccgatgtcagcggtcgcgccgaatgggaacagcccgaagtgctggcggtc
aaccgtctgcccatgaaggcgaccttcttcaactatgagagcgtggaaaaggccgtggcg
ggtcagatagcggcttcggccaactatctgtcgctggatggcacgtggaaattcgccctg
tccaaaacgccggaaacccgcccggtggacttctacaagcccgatttcgatgtctccgac
tggggcacggtgcaggtgcctggcatccttcaggcgcagggttatggcgtgccgctgttc
agcggagccggctatccgttcggggccaatgagccctatgtccgccacgaggtgaatgag
atcggttcctatcgccgcgattttgagttgcccaactggagcggcaaggatgtcttcctg
catatcggtgcggcgggcgcagcctattacatctgggtcaacgggcagaaggtcggctat
tcagaagattccaaactgccgtcagagttcgacctgacgccctatgtccgcacgggcgag
aacaccatcagtatcgagctttatcgctatgccgacggctcctaccttgaggatcaggac
ttctggcgtttgtcaggcatcgagcgctcggtctatctctatgccgaaccgaaaacgcgg
ctgggcgactatacggtcacggccctcctcgataaggcctattcggacggtgtttttgcg
ttggaggccgagctaaaaggggtcaagggggaggggaccatcaccgccaccctgtacgac
ggcgaaacggtcgtgctggcggccaggggacgggccacctcggataagccggcccggctt
tcgggcacgatcaaaaacgtcaggcaatggtcggcggagacgccgaacctctatcgcatg
gtcatcgaataccgtgatatcaagggtgcgctggtctcggccaccgcgaaaaagatcggc
ttccgcaccatcgaaatccgcaatggcgaagtgcaggtcaatggcaagcgcgttatgatc
aagggtgtcaaccgccacgagcacgacccccataccttccgcgtggtgtcgccggaaacg
acgcgcagggacatggaactgatgaagcaggcgcatgtcaatgcgctgcggatgtcgcac
tatcccaacgatccgcacgtctatgatctcgccgatgaatacggcctctatgtgatggat
gaggccaatattgagagccatacctatatggccatgatccgtgacatcaatcagcgctac
aaggcccaactgggctataagccgcactggtacgcagcgcacctcgaccgcgtgtcgcgc
atggtcgaacgcgacaagaacgtcacctcggtcgtcttctggtcactgggtaacgaggcc
ggcatcggtccggcctttgagcgcgcggcaaagtgggtgcgcgaccacgacaagacgcgc
ctgctcaactttctgggtcacggcacgatcggcgaggagcaccgccccaacgcctatgtc
gatatctacgcccccatgtacgacagcccggtcaagatggccgactatgcaaaggacagc
cgctacaaccagccgatgatccagtgcgaatacgcccatgctatgggtaacagtctgggc
aatctggaggactattgggagacgatccgcgcctataagaagctgcaaggcggctttatc
tgggactgggtcgatcaggcggtgatccgcaaggacgcaaaaggccgggattactgggcg
cagggcttcgacttccccaccggtgagtggcaggaggattcgaccattggtgacggcgtg
gtgcaggccgaccgcacgccggacccggaatattacgagcttcagaaggtctattcgccg
gttgtgtttgaaggcgatcccaaagcggggacgctgacggtcgtcaaccgcaacgacata
atcgacctgtcgggctatgccttcggttggaaacttgaaaaggacgggttgacggtaaag
accggcactttgatgggcgtcaatgccccggcggcaggccgcgcggcggtgccgctcgat
cttggtgctgtcagctatgacccggcggcggaatatgtgctgaccgtctcggccgtggct
gccgatgaccgtatgccgggcctgcccaaaggcgcatctatgggctggacgcagtttgtc
cttcagacgccgcgcccggcggccctgaccgccagcgggccggtgaaagtcacccgcacg
gcgtcagccgtcgaattgagcgccgggcggtcgcgactgacgcttgatgcgaagaccggc
ctgctgagcgcctatgtcgtcaacgggcagctgcttctgagcggcggtatgccctatttc
tggcgcgggccgaccgataatgacatcggcacgggtgtcgtcaccagccacgccatctgg
aaaaccctcagcgagaagcgcacgctggaaacgctggatgtgtctgacgccggagaggtc
aaggtcggctggcgcgtcggggcgggttcggtgcgctttacgaccacctggcacctgtac
ggcgacggtacactgaatgtgaaggccgactatgtgccgctacgcgatgacctgcctgat
ccgctgcgcgtcggcctaaggtttgcaaccagccctgccctgacggatcttcagtggtac
ggccgcgggccgcaggaatcctatgctgaccgtaagaccggggcggccatcggcctctat
cagggcaaggtggcggatcagtaccacaattacgtccggccgcaggagtcgggcaacaag
accgatgtgcgctggatgaccctgaccacggcgacggggcagggggtgcgcgtcaccggt
catcagcccctctcggccaatgccctggccttcccggtcgaggacctttatcagcagccg
gtggggcagcgccattcgtcggatattacgccgcgcggcgacggcacgctgatgattgat
ttgcttcagacgggggtgggcggcgatacagggtggaatacggttgggcgtccgcacgtc
aaataccgcatccccaatgcgccgctgagctatggctttacgctcagcccgctgggtcaa
tag

DBGET integrated database retrieval system