KEGG   Asticcacaulis excentricus: Astex_3420Help
Entry
Astex_3420        CDS       T01378                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
aex  Asticcacaulis excentricus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Astex_3420
   00500 Starch and sucrose metabolism
    Astex_3420
Enzymes [BR:aex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Astex_3420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1199882..1201000)
Genome map
AA seq 372 aa AA seqDB search
MSVRSTFLASAVTCLTLAALSLPAEAATRLKVRLDCGTRKACFTQVQAALDAAQKDSSDN
WIVIDVAAGDYYEKVTINRPKVRLRGAGAKRTRLHFNAVAETAGKYHRRNWGTPGSATLT
INADQVTVEGLTVENTFDYLRNDARLSDDPQKIKNSQGVAVLLDIDSDRVLFRKTAMLGY
QDTLFANGKRAIVRDSLIAGNIDFIFGNGQLLIEDSELRTRNRGAFTPPGEFHSFLLAPS
TPLSQSIGLVVYRSRLTREAGVPDGSVALARPWHPTTTFPDGRYADPNAVGQALFIGCEM
DAHIHPDHWTSMGGTARDGTKTAVFHPQDSRFFESGSTGPGARHRDIGIRWKDAPDIATV
RRQFSDGWPQAN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtacgctccacctttctcgccagcgccgtcacctgtctgacccttgcggcgctg
agcctccccgcagaggccgctacccgtctcaaggtgcgcctggactgcggtacgcgaaag
gcctgtttcacccaagtgcaggccgctctcgacgccgcgcaaaaggacagcagcgacaat
tggatcgtgatcgacgtggcggcgggtgactattatgaaaaggtgacgatcaaccgcccg
aaggtgcgcctgagaggggccggggcgaaacgcacgcgcctgcactttaacgctgtggcc
gaaacggcgggaaaataccatcgccgcaactggggcacgcccggctcagctaccctcacc
atcaatgccgatcaggtgacggtcgagggcctgacggttgaaaacaccttcgattacctc
agaaacgacgcgcgacttagcgacgacccgcagaagatcaaaaattcgcagggcgtcgcc
gtgctgctcgatatcgacagcgaccgcgtcctgttccgcaagaccgcgatgctcggctat
caggacacgctgtttgccaatggcaagcgggcgattgtccgcgacagcctgatcgccgga
aatatcgacttcatcttcggcaacgggcaattgctgatcgaagacagcgaactgcgcacc
cgtaatcgcggcgcgttcactccgccaggtgaatttcattccttcctgctggccccctcc
acccccctcagccagtccatcggcctcgtcgtctatcggtcgcgcctgacgcgcgaagcc
ggcgtgcctgacggctcggtggctctggcccggccctggcacccgacgaccaccttcccg
gacgggcgctacgccgatcccaacgccgtggggcaggccctgtttatcggctgcgaaatg
gacgcccacatccaccccgaccactggaccagcatgggcggcacggcgcgcgacggcacc
aagaccgccgtcttccacccacaggattcgcgcttctttgaaagcggctcgaccggaccg
ggggccagacaccgagacattggcatccgctggaaagacgcgccggatatcgcgaccgtg
cgccgtcagttctccgatggctggccgcaagcaaactga

DBGET integrated database retrieval system