KEGG   Asticcacaulis excentricus: Astex_3640Help
Entry
Astex_3640        CDS       T01378                                 

Definition
glycoside hydrolase family 35
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
aex  Asticcacaulis excentricus
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aex00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pASTEX01:complement(175450..177807)
Genome map
AA seq 785 aa AA seqDB search
MPFLPSRRLTLSAGMAASVSTLMPGAAALAKAHRFEIGPSDFLLDGRPIQIRCGEMHFPR
VPREYWPHRLKMIKAMGLNAVCAYLFWNYHEWNEGQFDWEGQRDAAAFCRMAQKEGLWVI
LRPGPYACAEWEMGGLPWWLLKAEGDAFLRTRAEAFTGPAHRWIEEVGRHLGPLQVTKGG
PILMVQVENEYGFFGNDLEYLQGMRKAVEQAGFDVPLFQCNPTHVVAKTHIPELLSVANF
GNDPETGFNTLRAVQRAPLMCGEYYSGWFDVWGAGHRTGGVQSSVADIKWMLQQNGSFSL
YMAHGGTSFGLWGGCDRPFQPDTTSYDYDAPISEAGRIGEKFEAYRSAMRPFLKAGERLP
APPPQKDTMALAPFSLEECAPVSAGYTSNPIQASELRSIEAYGISRGLVSYKAVLPAGPE
GVLKVNKARDLAWIRVDGKEVGTFDVRHQRTSVTIPARSYDAVIEILLYTIARVNFGVEV
HDRKGIHGPVTFTPKGSAPIPVVNWELRAIDFGADGNLPKLNWTKETASGPSFYRGTFTA
TSRDDSFLNMSNWGLGVVWINGRCLGRYWSIGPTQTMYLPGPWIKKGVNEIVVLDLTGPD
KPVVLGQTTPILDALRLDRDLPKPKSNRTLALANIPPTHSGAFRPGSSSQDVMFETPANG
RQFCLVSQNAHDQKGFAAVAEIALLDRAGQPINQSDWSVAYVDSEEVASLNGAAVNAING
QAADFWHSAVRSADVRDHPHYLAIDLGGTIEVAGFRYTPRQGGDGVTGRIKDYQVYVGDT
LVVET
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgccctttctcccctcgcgtcgcctgaccctgtccgctggtatggccgcctccgtatcg
acgctcatgccgggcgccgccgctctggctaaagcgcaccgttttgagattgggccatcc
gacttcctcctcgatggccgccctatccaaattcgatgtggcgagatgcatttcccccgt
gtaccccgcgagtactggccgcatcgcctcaagatgatcaaggcgatggggttaaatgcc
gtgtgcgcttatctgttctggaattaccacgagtggaacgagggccagtttgactgggag
gggcagagggatgccgccgccttttgtcgcatggcgcagaaagaaggtctttgggtcatt
cttcgaccgggcccctatgcctgtgccgaatgggagatggggggcctgccctggtggttg
ctgaaggccgaaggggatgcatttctgcgcacccgcgctgaggccttcaccgggccggcg
caccgctggattgaggaggtgggtcgccatcttggcccgcttcaggttaccaaaggcggc
cccatcctgatggtgcaggtcgagaacgaatacggatttttcggaaacgatcttgagtat
ttgcaaggcatgcgtaaggccgttgagcaggccgggtttgatgtgccactctttcagtgc
aatccgacccacgttgtcgccaaaacccatatcccggagctattgtccgttgccaacttc
ggcaatgatcctgaaacgggcttcaatactctgcgcgccgtccaacgcgcgcctttgatg
tgcggcgaatactattccgggtggtttgacgtctggggggccgggcatagaactggtggc
gttcaaagctcggtggccgacatcaagtggatgctccaacaaaatggctctttcagcctc
tacatggcgcacgggggcacgagctttgggctctggggaggttgtgaccgaccgtttcag
ccggacacgaccagctatgattatgatgcgcccattagcgaagcggggcggatcggggaa
aagttcgaggcctaccgctcagccatgcggccgtttttgaaagccggggaaaggttgccc
gccccccctccgcaaaaggacacgatggctctcgcccccttcagtcttgaagagtgtgcc
ccggtgagcgccggctacacctcgaaccctattcaggcgagtgagcttcgatccatcgaa
gcttacggcatcagtcgcggtctggtctcttataaggccgtcttgccggccgggcctgaa
ggcgtcctcaaggtgaataaggcgcgcgatctggcctggatccgggtcgatggaaaagag
gtaggcacgtttgatgtgcgccatcagcgcacgtcggtgactatccccgcccgatcatat
gatgcggtaattgaaatcctgctctataccatcgcgcgcgtgaatttcggggtggaggtt
catgatcgcaaaggcattcacgggccggtaacgtttacccccaaaggctccgcgcccata
cctgtcgtaaactgggaactgcgggcgattgatttcggcgccgatggcaaccttccgaag
ctcaactggacgaaggaaaccgcgagcgggccgtccttctatcgcggcactttcaccgcg
acgtcacgcgacgattcgttcctgaacatgtcgaactggggccttggcgtcgtgtggatc
aatggccgctgtctcggtcgctactggagcatcggccccactcagaccatgtatcttccg
ggcccttggattaaaaagggcgtgaatgaaattgtggtcctcgatcttacggggccagac
aagccggttgtgctcgggcaaacgacccccatactggacgcgttgcggctcgacagggat
ctcccgaagccgaagtccaatcgcacattggcgctcgcaaacatccctccgacccattcg
ggggcgttccgtccgggatcaagcagccaggacgtgatgttcgagacaccggctaacggc
cgacagttctgcctcgtctcgcaaaatgcgcatgaccagaaagggtttgccgccgtggcc
gaaattgccctcctcgatagggcgggacagcccatcaatcagtcggactggtcggtggcc
tatgtcgatagtgaggaggtcgcgagcctgaacggggcggccgtgaacgctatcaatggt
caggccgccgatttctggcattcggccgttcgctctgccgacgtccgcgatcacccgcat
tatctggcgattgacctcggcgggacaatcgaagttgcgggcttccgttatacgccgaga
caaggcggagacggtgtaacgggtcgcatcaaagactatcaggtctatgttggtgacacg
cttgtggtcgaaacttag

DBGET integrated database retrieval system