KEGG   Asticcacaulis excentricus: Astex_3787Help
Entry
Astex_3787        CDS       T01378                                 

Definition
disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
aex  Asticcacaulis excentricus
Brite
Enzymes [BR:aex01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Astex_3787
Secretion system [BR:aex02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Astex_3787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pASTEX02:83544..84350
Genome map
AA seq 268 aa AA seqDB search
MLPLSKPKLIVPAMLALVAIAVTGTFLLGPKTEETVKTKIAAHFPNSTVNSVSCKTAIGL
CEVVMGKNLLYATRDGRYVVVGAVLDLKARKDLTDQRLKELAAVDAATTSVEGQRVEAPV
KAAAGKLSVTLPKANAVIHNPGAPLKMTVFGDYSCGYCHQLFAQLAGTTNIEITEYPIAI
LGPQSAEKARLVMCAGDRAAAAEAAYTGGEIKTGADCAKFDAVIAENTRFAQANGINGTP
AIIRADGTVNAGFLPLPDLIRFLEGKNV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctctctctaagcccaaactcattgtgcctgctatgctggcactggtggcgatc
gcggtcaccggcaccttcctcctcggtccgaaaacagaggaaaccgtcaagacaaagatc
gcggctcattttcccaatagcacagtcaattcggtttcatgtaaaaccgccatcggcctg
tgcgaggtcgtcatggggaagaacctcctctatgcgacccgagacgggcgttatgtggtg
gtgggcgcggtcctcgacctcaaagcccgcaaagacctgaccgatcagcggttgaaggag
ttggcggcagtcgatgcggccaccacttcggttgaaggccagcgcgtcgaggctccggtg
aaagctgccgccggcaagctcagcgtcaccctgccaaaggctaacgccgtcatccataat
ccaggtgcgccgctgaagatgactgtcttcggtgactatagctgcggctactgccatcag
cttttcgctcaactggccggcacgaccaacatcgaaatcaccgaatatcccatcgccatt
ctgggcccacaatcggcggagaaggcgcgcctggttatgtgcgctggcgaccgggccgcg
gcggcggaagccgcctacacgggtggtgagatcaagacgggtgccgactgcgcaaagttt
gatgctgtgatcgccgagaacacccgcttcgcgcaggccaacggcatcaacgggacgccg
gcgatcatccgtgccgacggtacggtcaacgccggcttcctgcccttgccggatcttatc
cgcttcctggagggcaagaatgtttaa

DBGET integrated database retrieval system