KEGG   Alistipes finegoldii: Alfi_0028Help
Entry
Alfi_0028         CDS       T02133                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
afd  Alistipes finegoldii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28138..30201
Genome map
AA seq 687 aa AA seqDB search
MEKTTRRLPIVERDEWLLPAEQELNNRHERYMDKMNAIVQAAGSLVDYANGYRYFGWQRD
ETLDGWWLREWLPGAHDVYVFGDFNNWQRTEIRMQRDRHGVWSAFFPTAMYRDRLVHGSL
YKLHVHGDNGWLDRIPAYATRVVQDEATKNYTAQFWAPEPFDWRGDAFDISKNGNLLIYE
AHVGMAQEKEGVGTYREFTEKILPIIKKDGYNAVQLMAIAEHPYYGSFGYHVSSFFAPAS
RCGTPEELKELVRRAHELGLGVIMDLVHAHYVKNLNEGINELDGTDHHYSLPGKAGYQPY
WDSMLFDYGKDEVQHFLLSNVKYWLDEFHFDGYRFDGVTSMIYHHHGYVDFDCRERFFDA
GVNGDALTYLTLANRLVHDFRAGDVTIAEDVSGMPGMCIPDTDGGIGFDYRLGMAIPDFW
IKQLKEVPDEEWNIWEMWNVMTDRLPEVKTVAYAESHDQALVGDKTLAFRLMDKEMYFNM
DRASQSVVIDRGMALHKMIRLMTISTGGQAYLNFMGNEFGHPEWIDFPREGNGWSYAHAR
RQWSLAGNGFLRYAWLGDFDKAMIKLVKRYKVLADGYAWNLVMDECNKTMAFAHGDLLFV
FNWHPSASIPDYELPVQAPGKYVPLLSTDERRFGGQERQAMDGEHFSFPAQDGDNTERPH
IRIYNTSRTATVYLRTDGRQPSAVTGK
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaacgacccgcaggcttccgatcgtcgaacgcgacgagtggctgctccccgca
gagcaggagctcaacaaccgtcacgagcggtatatggacaaaatgaacgcaatcgtgcag
gcggcggggtcgctcgtcgattacgccaacggctaccgctatttcggctggcagcgcgac
gagacgctcgacggctggtggctgcgcgaatggctgcccggagcgcacgacgtctacgtc
ttcggcgatttcaacaactggcagcggaccgaaatccgcatgcagcgcgaccgccacggc
gtatggagcgccttcttccccacggcgatgtaccgtgacaggctggtgcacggctcgctc
tacaagctccacgtccatggcgacaacggctggctggaccgcattccggcctacgcgacg
cgcgtggtgcaggacgaggcgaccaaaaactacacggcgcagttctgggcgccggagccg
ttcgactggcggggcgacgcattcgacatttcgaaaaacggaaacctcctcatctacgag
gcacacgtgggcatggcgcaggagaaggagggcgtcgggacctaccgcgaattcacggag
aagatattacctataataaaaaaggacggctacaacgccgtgcagctcatggccatcgcc
gagcacccctattacgggtcgttcggctatcatgtgtcgagtttcttcgccccggcatcg
cgctgcggcacgcccgaagagctgaaggagctggtgcgccgcgcccacgagctggggctg
ggagtcatcatggacctcgtacacgcccactacgtgaagaacctcaacgaaggcatcaac
gagctggacggcacggaccaccactattcgctgcccggaaaggcgggctaccagccctat
tgggactcgatgctcttcgactacggcaaggacgaggtgcagcatttcctgctttcgaac
gtcaaatactggctcgacgaattccatttcgacggctaccgcttcgacggcgtgacctcg
atgatctaccaccaccacggctacgtcgatttcgactgccgcgaacgtttcttcgacgcg
ggggtgaacggcgacgcgctgacctatctgacgctggccaaccggctggtgcacgacttc
cgcgcgggcgacgtgaccatcgccgaggacgtgtcgggcatgccggggatgtgcattccc
gacacggacggaggcatcggcttcgactaccggctggggatggccattcccgatttctgg
atcaagcagctcaaggaggtgcccgacgaggagtggaacatctgggagatgtggaacgtg
atgaccgaccgcctgcccgaagtgaagacggtggcctacgccgagtcgcacgatcaggcg
ctggtgggcgacaagacgctggcgttcaggctgatggacaaggagatgtatttcaacatg
gaccgcgcgtcgcagagcgtggtgatcgaccgcggtatggcgctgcacaagatgatccgc
ctgatgaccatttcgacgggcgggcaggcctacctcaacttcatgggcaacgagttcggg
catcccgaatggatcgacttcccgcgcgagggcaacggctggagctacgcccacgcccgg
cggcagtggtcgctggccgggaacgggttcctgcgctatgcatggctgggggatttcgac
aaggcgatgatcaaactggtgaagcggtacaaggtgctggccgacggctacgcgtggaat
ctcgtgatggacgaatgcaacaagacgatggcctttgcccacggcgacctgctgttcgtc
ttcaactggcacccctcggcgtcgattcccgactacgagctgcccgtgcaggcgcccggc
aaatacgtgcccctgctctcgaccgacgaacggcgtttcggcgggcaggagcggcaggcg
atggacggcgagcacttctcgttcccggcgcaggacggggataacaccgagcggccgcat
atccgcatctacaatacttcgcgcacggcgacggtatatctgagaaccgacggacgacaa
ccctccgccgtgaccgggaagtga

DBGET integrated database retrieval system