KEGG   Alistipes finegoldii: Alfi_0052Help
Entry
Alfi_0052         CDS       T02133                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
afd  Alistipes finegoldii
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Alfi_0052
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Alfi_0052
Enzymes [BR:afd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Alfi_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(54602..56857)
Genome map
AA seq 751 aa AA seqDB search
MWLMACTGPAPDERPVLIPAPQKTIWGDGTYRLPERLQLGIADTVLIAAAGYVNEVLAPY
GTVAVDRCDRGDIVLELDSAALPPEGYRLSVTHAGVRIGGGSYRGVVNGIATLRQLLPAK
AGSGAKIPYAEIADRPAFGWRGVMLDVSRHFFDKEEIFTLLDQMARLKLNKFHWHLTDDQ
GWRIEIPCYPELTQEGAWRLFNRQDTLCMGRAAREQNDDFLLPVRRLRTDGADTLYGGYY
TRKDIREVVAYAAVRGIDVIPEIDMPGHCLQAIDSYPWLACFGRGSWGQSFSSPLCVGKD
RTLAFCESVWEELFELFPYEYVHMGGDEVDKSNWKRCPDCQTRMRAEGLPDEAALQAWFM
HRMQRFCEARGRRMIGWDEILEGGAVPGATVMWWRPWEPQSVSAATRQGCEVVLCPQSWF
YFSLEEDANSLARICRFDMLPDSLSDAQKRQIKGVQGNLWTEKIPTWSRAEYMFYPRLLV
LAEKGWTEPGKFDEDAFMSRLLDYCRRLDDEGVNYRIPSLTNYHAVSVFTDSVRTAVVCP
LPGAVLRYTLDGSVPTVNSPRYDAPLVIRDDCMLHIRPYHADGRTGDWITVRYEKQDYAR
PLEPRDTEPGLCVDWYFRRFPGCDAIGIPETLYAAGGRCVVDSVCFPRAAAGRRAVGMIF
RGYIDIPATGIYTFALASDDGAILRIGGRVVVDNDGEHPLLEKSGQVALSAGLHPLELRY
FDYNGGEIRLVLLGDDGARHPLDTDLLRHDP
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcatggcctgcaccgggcctgcgccggatgaacggcccgtgctgattcccgct
ccgcagaaaacgatatggggcgacgggacctaccggctccctgaacggttgcagttgggc
atcgccgatacggttctcatcgccgcggccggctacgtgaacgaggtgctggcgccttat
ggcactgtcgccgtagatcggtgcgaccggggagatatcgtgttggaactcgattcggcc
gccttgccgcctgaagggtaccgcctgtcggtgacgcacgccggcgtacggatcgggggc
ggttcctaccggggcgtcgtcaatggcatcgccacgctgcggcagctgttgccagcgaaa
gccggaagcggagcgaagattccttatgcggagatcgccgatcggccggcgttcggatgg
cgcggcgtgatgctcgacgtgagccggcactttttcgacaaagaggagatttttacgctg
ctggaccagatggcccggctcaagctcaacaaatttcattggcatctgaccgacgatcag
ggctggcggattgagattccgtgttatcccgaactcacgcaagagggggcatggcggctt
ttcaatcggcaggacacgttgtgcatgggccgcgcggcgcgggaacaaaacgacgatttc
ctgcttcccgtccggcggctgcggaccgatggcgccgacacgctttacgggggatattat
acacggaaggatatccgcgaggtggtggcctatgccgcggttcggggtatcgacgtgatt
cccgaaatcgacatgcccggccattgcttgcaggccatcgacagctatccgtggctggcc
tgtttcggacgcggttcgtgggggcaatccttctcttcgccgctgtgcgtgggcaaggac
cggacactggcgttctgcgaaagtgtctgggaagagcttttcgaacttttcccctatgaa
tatgttcacatgggtggcgacgaggtcgataagagcaactggaaacgttgtcccgactgt
cagacccgtatgcgtgccgaagggctgcctgacgaagcggctcttcaggcgtggttcatg
caccgtatgcagcgcttttgcgaagcccgcggacgccgcatgatcggctgggacgagata
ctggaaggcggagccgttcccggtgctacggtcatgtggtggcggccgtgggaaccgcag
tccgtgagtgcggccacccggcagggctgtgaggtcgtcctctgtccgcagtcgtggttc
tatttctcgctggaagaggacgcaaactcgctcgcgcgcatctgtcgcttcgatatgctg
ccggactcgctgtccgatgcgcagaaaagacagatcaaaggtgtgcagggcaacctctgg
accgaaaaaatccccacgtggtcccgtgcggaatatatgttttacccgcgcctgctcgtt
ttggccgagaaagggtggaccgagccgggcaagttcgacgaggacgctttcatgtcgcgg
ctgctggactattgccgacggctggatgatgagggtgtcaactatcggattccgtcgctg
acgaattatcatgctgtcagcgtcttcaccgattcggtccggactgccgtcgtctgtccg
ctgcccggtgccgttttgcgctatacactcgacggctcggtgccgaccgtaaactcgccg
cgttacgacgccccgctggttatccgcgacgattgtatgctgcacatccggccctaccat
gccgacggccgtacgggcgactggataaccgtccgctatgagaagcaggattatgcgcgg
cctttggagccgcgggacactgaacccggtttgtgcgtcgattggtacttccgccgtttt
cccggttgcgacgcgatcggcattccggagactctttacgctgccggcggccgttgtgtc
gtcgattcggtctgtttccctcgtgcggctgccggccgccgggccgtcgggatgattttc
cgggggtatatcgacattccggcaaccgggatctatacctttgcgctcgcttccgacgac
ggcgccatcctgcgtatcggcggcagggtggtggttgataacgacggagaacatcctctg
ctcgaaaagagcggacaggttgcgttgtctgcgggcctgcatccgctcgaactgcgctat
ttcgattacaacggcggcgagattcgtcttgtcctgctcggcgacgacggtgcccgccac
ccgctcgataccgacctgctccgccacgatccgtga

DBGET integrated database retrieval system