KEGG   Alistipes finegoldii: Alfi_1036Help
Entry
Alfi_1036         CDS       T02133                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
afd  Alistipes finegoldii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:afd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Alfi_1036
Enzymes [BR:afd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Alfi_1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1110643..1111434)
Genome map
AA seq 263 aa AA seqDB search
MKIFERITKRYALQNYYLRRNFYWPDTLPEILDYWQQHNDLPFLYGGDNWPYDAMCERQR
RKGVYASQYLTPDRTACQMAALAVRYFDNDSRVVGAANLNLLLQQALNPSDPSLNRGGYT
YRQGDRVMQQRNNYDKDVFNGDLGYIREVDTEERTLKVDFDGKWVEYDVTELDELTLAYA
TTIHKAQGSEYPIVVMPVLMTHFVMLQRNLIYTGITRAKKICVLIGATKALAYAVRNVSV
LKRNTSLRERLNPSLTTDGKLRG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctttgaaagaatcacaaaacgctatgcgcttcagaattactatctgcggcgc
aatttctattggccggatacgctgccggagattctcgattattggcagcagcacaatgac
ctgccattcctctacggcggcgataactggccgtatgatgcaatgtgcgagcggcagcgc
cgcaagggcgtctatgcttcgcaatacctgacacccgaccgcacggcctgccagatggcg
gcactggccgtgcgatatttcgacaatgacagccgtgtcgtgggcgccgcgaacctgaac
ctgctgttgcagcaggcactgaatccttcggacccgagcctcaatcgcggcggctatacc
tatcgtcagggcgatcgtgtgatgcagcagcgcaacaactacgacaaggatgtgttcaac
ggcgatctgggttatatccgggaggtggatacggaggagaggacgttgaaagtcgatttc
gacggcaaatgggtcgagtacgatgtcacggaactcgacgaactgacgctggcctacgcc
acgacgatccacaaggcccaagggtcggaatacccgattgtagtcatgccggtgctgatg
acccacttcgtgatgctccagcgcaacctgatctatacgggtatcacgcgcgccaaaaag
atctgcgtgctgatcggtgcgacgaaagccttggcttatgccgtccgcaacgtgtccgtg
ctgaaacgcaatacgagccttcgggagcggttgaatccctccctgacgaccgacgggaaa
ctccggggctga

DBGET integrated database retrieval system