KEGG   Alistipes finegoldii: Alfi_1036Help
Entry
Alfi_1036         CDS       T02133                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
afd  Alistipes finegoldii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:afd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1110643..1111434)
Genome map
AA seq 263 aa AA seqDB search
MKIFERITKRYALQNYYLRRNFYWPDTLPEILDYWQQHNDLPFLYGGDNWPYDAMCERQR
RKGVYASQYLTPDRTACQMAALAVRYFDNDSRVVGAANLNLLLQQALNPSDPSLNRGGYT
YRQGDRVMQQRNNYDKDVFNGDLGYIREVDTEERTLKVDFDGKWVEYDVTELDELTLAYA
TTIHKAQGSEYPIVVMPVLMTHFVMLQRNLIYTGITRAKKICVLIGATKALAYAVRNVSV
LKRNTSLRERLNPSLTTDGKLRG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctttgaaagaatcacaaaacgctatgcgcttcagaattactatctgcggcgc
aatttctattggccggatacgctgccggagattctcgattattggcagcagcacaatgac
ctgccattcctctacggcggcgataactggccgtatgatgcaatgtgcgagcggcagcgc
cgcaagggcgtctatgcttcgcaatacctgacacccgaccgcacggcctgccagatggcg
gcactggccgtgcgatatttcgacaatgacagccgtgtcgtgggcgccgcgaacctgaac
ctgctgttgcagcaggcactgaatccttcggacccgagcctcaatcgcggcggctatacc
tatcgtcagggcgatcgtgtgatgcagcagcgcaacaactacgacaaggatgtgttcaac
ggcgatctgggttatatccgggaggtggatacggaggagaggacgttgaaagtcgatttc
gacggcaaatgggtcgagtacgatgtcacggaactcgacgaactgacgctggcctacgcc
acgacgatccacaaggcccaagggtcggaatacccgattgtagtcatgccggtgctgatg
acccacttcgtgatgctccagcgcaacctgatctatacgggtatcacgcgcgccaaaaag
atctgcgtgctgatcggtgcgacgaaagccttggcttatgccgtccgcaacgtgtccgtg
ctgaaacgcaatacgagccttcgggagcggttgaatccctccctgacgaccgacgggaaa
ctccggggctga

DBGET integrated database retrieval system