KEGG   Alistipes finegoldii: Alfi_1091Help
Entry
Alfi_1091         CDS       T02133                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
afd  Alistipes finegoldii
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Alfi_1091
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Alfi_1091
Enzymes [BR:afd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Alfi_1091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1178846..1180717
Genome map
AA seq 623 aa AA seqDB search
MNERLLPGRIRSGWGVSILFLCLMALSGCCSHEAIRVNLIPRPAEMEVLSGYFQPGNTTV
DDFTTVVVDNSRMDALGREGYELTVDRSSVRLTAATQTGIFYGKRTLEQLMTDKGIPCVR
VSDRPRFAYRGMHMDVSRHFFPKSQVLKMLDEMARYKLNVFHFHLTDNGGWRIRIDKYPR
LTAEGAFRTQRDWYAWWDRNDRRYLPEGTPGAYGGYFTKEDIREIVTYAAERHITVIPEI
EFPAHSDAVFIGYPELCCTGKPYTTGEFCVGNEQVYTFMEDVLTEVMELFPSKYIHIGGD
EARKVAWATCPKCQALIERERLDGIQGLQPYMIARIQDFLASKGRVMVGWDEILHNELHS
ETLVMSYRGQKGAIEAANRGNYAVMTPGEVLYFDWYQADPSTQPRAMYGYSPIKKMYAFE
PVPADPESAARNESIIRAEFVDPAAVEPIRADRADRIVGVQGCTWAEYIEDEEQQEYMIF
PRLLAVAELAWTPQEKREWCDFKVRMNSHIPLLQQRGLNTFTLSDEVEITTRIRSGNRAV
EVTLDCEKYPAEIRYTLDGTPPTPDASLYEAPFTVTDSTVVRAAVCRDGVIRSPERKQLV
TLAAEIDNYYPFDVPEIWKEYFD
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacgattgttgccgggacgtatccgttcgggctggggagtctctattcttttt
ctttgtttaatggccctttccgggtgctgttcacacgaagcgattcgggtgaatctcatt
ccgcgcccggcggaaatggaggtgctgtccgggtattttcagccgggaaacacgacggtg
gacgacttcacgaccgtagttgtggacaattcccggatggatgcgctgggacgggaggga
tacgaacttacggtcgatcgctcgtcggtgagactcacggctgccacccagaccggcatt
ttctatgggaaacggacgctggaacagttgatgaccgacaagggtattccttgcgtaagg
gtcagcgaccggccccggtttgcctaccggggcatgcacatggatgtatcgcggcatttc
tttccgaaaagtcaggtgctgaagatgctggacgaaatggcccgctacaaactcaacgta
ttccatttccatctgaccgataacggtggttggcgcatccggatcgacaaatatccgcgg
ctcaccgccgaaggggcattccgcacgcagcgggattggtatgcatggtgggaccggaac
gaccgtcgctatcttcccgagggaactccgggcgcttacggcggatatttcaccaaagag
gacatccgtgagatcgtgacctacgccgccgagcggcacattacggtcattcccgagatc
gaattcccggcgcattccgacgccgtgttcatcggctatccggagttgtgctgtacgggc
aaaccttatacgacgggagaattttgtgtcggcaacgaacaggtatatacttttatggag
gatgtgcttaccgaagttatggagcttttcccttcgaaatacatccatatcggaggcgac
gaggcccggaaagtcgcctgggcgacctgtccgaaatgccaggccctgatcgagcgggag
agacttgacgggatacagggactccaaccctatatgatcgcccgtatccaggattttctc
gcttcgaaagggcgggttatggtcggctgggatgaaatactgcacaacgaactgcattcc
gaaaccttggttatgtcgtatcgtggacagaaaggggctatcgaagccgctaatcggggc
aattatgccgtaatgacacccggtgaagtgctctatttcgactggtatcaggccgatcct
tccactcagccgcgtgccatgtacggatattctcccattaaaaagatgtacgctttcgag
ccggtgccggctgatccggaatcggcggcccgcaacgagtcgatcatccgggccgaattc
gtggaccctgcggccgtggagccgatccgggcggatcgcgccgaccgcatcgtcggtgtg
cagggatgtacgtgggctgaatatatcgaagatgaagagcaacaggaatacatgatcttt
ccgcgtctgctggctgtggcagaattggcatggacaccgcaggagaagcgcgaatggtgc
gatttcaaagtccggatgaactcccatatcccactgttgcagcaacgggggctaaatact
tttacgctgagcgacgaagttgagatcacgactcgcattcgttccggaaatagagcggtt
gaggtgactctcgactgtgagaaatatcccgcagagattcgctacacgttagacggaacc
ccgccgacgcccgacgcttcgctttacgaagctccttttaccgtgaccgattcgacggtg
gtccgggccgccgtatgtcgggatggagtgattcgaagtcctgaacggaaacaattggtt
actctcgccgcggagatcgacaactattatccgttcgatgtgccggaaatctggaaagaa
tatttcgattaa

DBGET integrated database retrieval system