KEGG   Alistipes finegoldii: Alfi_1171Help
Entry
Alfi_1171         CDS       T02133                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
afd  Alistipes finegoldii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:afd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1273534..1274130)
Genome map
AA seq 198 aa AA seqDB search
MSKLLQDVVGELSKLPGVGRRTALRLAIHILRMERESVAEMTESIDRFRNDVKYCAECNN
LSDEEVCPICLDDERDRTTICVVEQVADVLSIENTHQYKGLYHVLGGVISPMQGISPSDL
KIDLLTERIARGGVKEVILAISTSVEGETTLFYLMNRLRQFPGVKVTSIARGIGFGDELE
YVDELTITHALRNRREVE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattactacaggacgtcgtcggcgagttgtcgaagcttccgggcgtggggcgc
cgcacggcgctgcgtctcgccatccacatcctgcgcatggagcgggagtcggtggccgaa
atgacggagagcatcgaccgtttccgcaacgacgtgaaatactgcgccgagtgcaacaac
ctttcggacgaggaggtgtgcccgatctgtctggacgacgagcgcgaccggaccacgatc
tgcgtcgtggagcaggtcgccgacgtgctctcgatcgagaatacccaccagtacaagggt
ctctaccacgtgctgggcggggtcatttcgccgatgcagggcatttcgccctcggatctg
aagatcgacctgctgaccgagcgcatcgcccgcggcggcgtgaaggaggtgattctcgcc
atttcgacctcggtcgagggcgagacgacgctcttctacctgatgaaccgcctgcggcag
ttccccggcgtgaaagtcacctcgatcgcccgcggcatcggcttcggcgacgagctggaa
tacgtcgacgagctgaccatcacgcatgctttgcggaaccgccgcgaagtcgaatga

DBGET integrated database retrieval system