KEGG   Alistipes finegoldii: Alfi_1237Help
Entry
Alfi_1237         CDS       T02133                                 

Definition
alpha-glucan phosphorylase
Orthology
K16153  
phosphorylase / glycogen(starch) synthase [EC:2.4.1.1 2.4.1.11]
Organism
afd  Alistipes finegoldii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Alfi_1237
Enzymes [BR:afd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Alfi_1237
    2.4.1.11  glycogen(starch) synthase
     Alfi_1237
Glycosyltransferases [BR:afd01003]
 Polysaccharide
  Storage polysaccharide
   Alfi_1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1352140..1356390
Genome map
AA seq 1416 aa AA seqDB search
MSNAKLTPDYLFEVSWEVCNKIGGIHTVVSTKAQTAIRKFNERYILIGPDLQHEGVNPEF
EEDPNLLKTWRQGLYAEGIRIRVGHWKIKGEPTAILVDFTSLIPRKDEILKKLWEAYHVD
SISGQWDYIEPVLFGYAAGAVIASYVENFCTATDKIAAHFHEWMTAAGGLYLRRHAPYVA
TLFTTHATVMGRCIAGNHLPLYTDLTKFNADELARQFNVVAKHSIEKAAAAYHDAFVTVS
DITANECKFLLGREPDCITPNGFENDFVWTGEEYDAKRAEARKTMISVAEACLGEKFAEE
PLIVGTSGRYEFRNKGIDVFIESLKKLAASPRLKRQVLAYITVPAANRGPRADLQAHLAD
PSKPIDGGQYKYTTHYLEYQSSDPIVNALNGSILTTPDSKVKVIFVPTYLNKADGIFGKD
YYELLVGMDMTVFPSYYEPWGYTPLESVAFSVPTITTTLAGFGLWAAKQREHAGVEIVLR
DDYNDQEVEEKIAESLLHFSLLDDKHVNEMRVSAYEISETALWEHLFAAYEQAYSEAVES
SVIRTNRAVLDEGGNRNEQINFVRQQLFAEKPNWNRMMVDKTLPKRLHALEELSRNLWWC
WNPGTRDLFESIDHALWAECERNPIAFLDKMSVERMKELEQDTNFLSQLDAVYAQFRDYM
NEKPDPKATSISYFSMEYGLHSSLKIYSGGLGILAGDYLKEASDKNVPMAAVGLLYRYGY
FTQRLSSQGAQEATYEAQNFYKLPISPVRDEAGNWMTVTIAFPGRTLWARVWKCQVGRTD
LYLLDADFEANLEEDRQITHHLYGGDWENRLKQEILLGIGGIRALRKLGIKHDVFHCNEG
HAAFIGIERIRDLVTHKKLSFSEALEVIRSSSLFTTHTPVPAGHDAFPESMIRQYMSHYP
DVLGITWEQYINLGKTNPNDPNEKFSMSVLACNLSQEVNGVSWLHGEVSKDILGSMWPGY
FKNELHIGYVTNGVHFPTWIATSMRRLYARYFADGFEGHTYDIPAWQKVHQIPDEELWNE
RMYLKNKLVKHIRRRYSDPNQVRLDSPRQMIQIIEGIKPDVLTIGFARRFATYKRAYLLF
TNLDRLSAIVNNKERPVQFIFAGKAHPNDKPGQDLIKRIVEVAAMPQFVGKILFLQNYDM
ELARRMVQGVDVWLNTPTRPLEASGTSGEKCVMNGVLQFSVLDGWWVEGYKEGAGWMLPM
ERTFADQGYQDELDAEMIYNTIEEQIVPKYYDRGSDGIPHQWVDSVKKCVADIASNFTTN
RMLGDYEERFYNKLAARKREIVEGGYKLAREIAAWKRKVSAAWDKVRVIDVQRVRIDDEA
IFVGEKYHFEVTVDIANLRPEDIGVEMVIAQQIVGGGKVNVTRTIGLKHTKTDGSRVTYA
LDYVPGEAGTFDVALRLYPYNPHLPHRMDFALVKWA
NT seq 4251 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgcaaaactaacccccgattacctgttcgaggtaagttgggaggtctgcaac
aaaatcggcggcatccatacggtagtctcgaccaaagcgcaaacggccatccggaaattc
aacgagcgctatatcctcatcggacccgacctgcagcacgaaggcgtaaaccccgaattc
gaggaggatcccaacctgctgaagacatggcgtcaggggctttacgccgaaggcatccgc
atccgcgtgggacactggaaaatcaagggcgaaccgacggcgatactggtggacttcacc
tcgctgattccccgcaaggacgaaatactcaagaaactctgggaggcctaccacgtcgat
tcgatttcgggtcagtgggactacatcgagcccgtgctcttcggctacgccgcaggcgcg
gtgatcgcctcctatgtcgagaacttctgcaccgcgaccgacaagatcgccgcccatttc
cacgaatggatgaccgcggcgggcggtctctacctgcgccgccatgcgccttatgtggcg
acactcttcaccacgcacgccacggtcatgggccgctgcatcgcgggcaaccacctgccg
ctctacaccgacctgaccaagttcaatgccgacgagctggcacgccagttcaacgtcgtg
gccaaacactcgatcgagaaggccgccgctgcctaccacgacgcattcgtcacggtcagc
gacatcacggccaacgagtgcaaattcctgctgggccgcgagcctgactgcatcacgccc
aacggcttcgaaaacgacttcgtctggaccggcgaggagtacgacgcgaagcgcgccgaa
gcccgcaaaacgatgatctcggtggccgaagcgtgtctgggcgaaaagttcgccgaggag
ccgctgatcgtcggcaccagcggacgctacgaattccgcaacaagggcatcgacgtattc
atcgaatcgctcaagaaactggccgcatcgccccggctcaaacgtcaggtgctggcctat
atcaccgtgcccgccgccaaccgcggtccgcgcgcggacctgcaggcgcatctggccgac
ccgtcgaaacccatcgacggcgggcagtacaaatacacgacccactacctcgaataccag
agcagcgacccgatcgttaacgccctcaacggcagcattctgaccacgcccgattcgaag
gtgaaggtgatcttcgttccgacctacctcaacaaggccgacggcatcttcggcaaggat
tactacgaactgctggtcggcatggacatgaccgtattcccctcctactacgaaccgtgg
ggatacacgccgctcgaatcggtggccttctccgtgccgacgatcaccacgacgctggcc
ggattcggtctctgggcggccaaacagcgcgagcatgcgggcgtggagatcgttctgcgc
gacgactacaacgatcaggaggtcgaagagaagatcgccgagtcgctgctgcacttcagc
ctgctggacgacaagcacgtgaacgagatgcgcgtgtcggcctacgaaatctccgaaacg
gcgctctgggaacacctcttcgccgcctacgagcaggcttactccgaggctgtcgaaagt
tcggtcatccgcaccaaccgcgccgtgctggacgagggcggaaaccgcaacgagcagatc
aacttcgtgcgccagcagcttttcgccgagaagcccaactggaaccgcatgatggtggac
aagaccctgcccaaacggctgcacgccctcgaagagctgtcgcgcaacctctggtggtgc
tggaatcccggcacgcgcgacctgttcgaaagcatcgaccatgcgttgtgggccgagtgc
gaacgcaatccgatcgcattcctcgacaaaatgagcgtggagcgcatgaaggagcttgaa
caggatacgaatttcctcagccagctcgacgccgtatatgcgcagttccgcgactacatg
aacgagaaacccgatccgaaggcgacctcgatctcctacttctcgatggagtacggcctg
cattcgtcgctcaagatttactccggcggtctgggcattctggccggcgactacctcaag
gaggcgtcggacaagaacgttccgatggcggccgtgggcctgctgtaccgttacggctac
ttcacgcagcggctctcgtcgcagggcgcgcaggaggcgacctacgaagcgcagaacttc
tacaagctgccgatctcgcccgtgcgcgacgaagccggcaactggatgacggtcaccatc
gccttccccggacgtacgctctgggcacgcgtctggaaatgtcaggtgggacgcacggac
ctctacctactcgacgcggacttcgaggccaacctcgaagaggaccggcagattacgcac
cacctctacggcggcgactgggagaaccggctcaagcaggagatcctgctcggcatcggc
ggtatccgcgcgctgcgcaagctgggcatcaaacacgacgtattccactgcaacgaggga
cacgccgcattcatcggcatcgagcgcatccgcgatctggtgacccacaagaagctctcc
ttctcggaggcgctggaggtgatccgctcgtcgtcgctcttcacgacccatacgccggtt
cccgcaggccacgacgcattccccgaatcgatgatccgccagtacatgtcgcactatccc
gacgtgctgggaatcacgtgggaacagtatatcaacctcggcaagaccaaccccaacgac
cccaacgagaagttctcgatgtcggtgctggcctgcaacctctcgcaggaggtgaacggc
gtgtcgtggctccacggcgaggtgtcgaaggatattctgggcagcatgtggccgggctac
ttcaaaaacgagcttcatatcgggtacgtcaccaacggcgtgcacttcccgacgtggatc
gcgaccagcatgcgccgcctgtacgcccgctatttcgccgacggattcgaggggcacacc
tacgacatcccggcatggcagaaggtccaccagattcccgacgaagagctgtggaacgag
cgcatgtatctcaagaacaagctcgtaaagcatatccgccgccgctacagcgaccccaat
caggtgcgtctcgactcgccgcgccagatgattcagatcatcgagggcatcaagcccgac
gtgctgaccatcggtttcgcccgccgcttcgccacctacaagcgcgcctacctgctgttc
accaacctcgaccggctgtcggcgatcgtcaacaacaaggagcgtcccgtgcagttcatc
ttcgcgggcaaagcgcaccctaacgacaagccgggtcaggacctcatcaaacgcatcgtc
gaagtggccgccatgccgcagttcgtaggcaagatcctcttcctgcagaattacgacatg
gagctggcccgccgcatggtgcagggcgtggacgtatggctcaacaccccgacccgtccg
ctcgaagcgtcgggcacgtcgggcgagaagtgcgtcatgaacggcgtgctccagttctcg
gtactcgacggatggtgggtcgaaggctacaaggagggcgcgggatggatgctgcccatg
gaacgcacgttcgccgatcagggctatcaggacgagcttgacgccgagatgatttacaac
accatcgaggagcagatcgtgccgaaatactacgaccgcggcagcgacggcattcctcac
cagtgggtggattcggtcaaaaagtgcgtcgccgacatcgcgtcgaacttcacgaccaac
cgcatgctgggggattacgaggagcggttctacaacaagctcgcggcccgcaagcgcgaa
atcgtcgaaggcggctacaagctggcccgcgagatcgcggcgtggaagcgcaaggtttcg
gccgcatgggacaaggtccgcgtgatcgacgtccagcgcgtgaggatcgacgacgaggcg
atcttcgtcggcgagaagtaccacttcgaagtgacggtggacatcgccaacctccggcct
gaggatatcggcgtcgagatggtcatcgcccagcagatcgtcggcggcggcaaggtgaac
gtaacccgcaccatcgggctgaaacacaccaaaaccgacggcagccgcgtgacctatgcg
ctggattacgttcccggcgaggccggcacgttcgacgtggcgctgcgtctctatccctac
aacccccacctgccgcaccgcatggattttgcattggtaaagtgggcctag

DBGET integrated database retrieval system