KEGG   Alistipes finegoldii: Alfi_1268Help
Entry
Alfi_1268         CDS       T02133                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
afd  Alistipes finegoldii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:afd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:afd00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:afd00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afd00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:afd00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:afd00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1397716..1398720)
Genome map
AA seq 334 aa AA seqDB search
MKKLAIGVDIGGINTAFGLVDENGDLYAESVISTKKYPHVDDYPAYVEDLCQAMHALADS
LSFEYELTGIGIGAPNANFHKGTVENPANLWKFREGDPNPDESRRLFPLADDIGRCFGGV
KVLVTNDANAATIGEMIYGNAKGMRDFVMITLGTGLGSGFVSNGEMIYGHDGFAGEFGHI
IVERNGRECGCGRRGCLETYVSATGIKRTAFELMATMTAPSKLRDIAFADFDASMISAAA
EQGDPVALEAFRYTGELLGRALADVVTVTSPEAIFLFGGLSKAGKLIFEPTQWYMEENML
FVFKNKVKLLPSGIQGKNAAILGASALIWQQENK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcgcgatcggcgtggatatcggcggcatcaacaccgccttcggccttgtc
gatgagaacggcgacctctatgccgaatcggtcatttcgaccaagaaatatcctcatgta
gacgattatccggcttacgtcgaagatttgtgtcaggcgatgcacgcgctggccgacagt
ctttcgttcgaatacgagctgacgggcatcggcatcggcgcccccaacgccaatttccac
aagggtacggtcgagaatcccgccaacctctggaaattccgcgagggcgaccccaatccc
gacgagagccgccgtctctttccgctggccgacgatatcggcagatgtttcggcggcgtg
aaggtgctggtgaccaacgacgccaatgccgcgacgatcggcgagatgatttacggcaac
gccaaaggtatgcgcgacttcgtgatgattacgctcggcacgggactcggttcgggcttc
gtctccaacggcgagatgatctacggacacgacggttttgccggcgagttcggtcatatc
atcgtcgagcgcaacggccgcgagtgcggctgcgggcgcaggggctgtctggagacctat
gtttcggcgacgggcatcaagcgcacggctttcgagctgatggcgacgatgacggcgccc
agcaaactgcgcgacattgccttcgcggacttcgatgcgtcgatgatttcggctgcggcg
gagcagggcgacccggtggcgctggaggctttccgctatacgggcgagctgctgggccgt
gcattggccgacgtggtgacggtcacctctcccgaagcgattttcctcttcggaggtctg
tcgaaggcgggcaagctgatcttcgaacccacgcagtggtacatggaagagaacatgctt
ttcgtattcaagaacaaggtgaaactgcttccgagcggtattcagggcaagaacgccgcc
attctcggcgcttcggccctgatctggcagcaggagaacaaataa

DBGET integrated database retrieval system