KEGG   Alistipes finegoldii: Alfi_1336Help
Entry
Alfi_1336         CDS       T02133                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
afd  Alistipes finegoldii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Alfi_1336
Enzymes [BR:afd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Alfi_1336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1480842..1481702
Genome map
AA seq 286 aa AA seqDB search
MKVKKVLVSQPRPAIIEKSPFYELSEKYKVEIAYKPFIRVVGVSLKEFRAQRVEILTHTA
VIFTSRTTVDSFFHICEEARITVPETMKYICQTEAVALYLQKYIVYRKRKISFADGSFTS
FIELIIKHKDEKFLLALSEPHKPELPETLAKLKMSFDPAILARTVAADMDDIALTDYGLL
ALYSPSDVKTLVEKFSTENLPAVAVFGEGTLRAALDAGITVLANAPTPEAPSMVKAIDIY
LNKVQKGEEIAPVELITDTQKEEFIRSQQHKLAKKSRARRPADPRK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtaaaaaaagtattggtttcgcagccgaggcctgcaattatcgagaagtccccg
ttctacgaattatccgagaaatacaaagtagagatcgcctataaaccgtttatccgcgta
gtaggcgtttcgctgaaagagttccgcgcacaacgggtcgaaatactgacgcacacggcc
gtaattttcacttcgcgcacgacggtagacagtttcttccacatctgcgaagaggcccgc
atcacggtgcccgaaaccatgaaatacatttgccagacggaagccgttgcgctctatctg
caaaaatacatcgtctaccgcaaacgcaagatttcgtttgccgacggctcgttcacctcg
ttcatcgagctgatcatcaagcacaaggacgagaagttcctgctggcgctgagcgaacct
cacaaacctgagcttcccgaaacgctcgccaagctcaaaatgtcgttcgatccggctatt
ctggcccgtacggtcgctgcggacatggacgacatcgcgctgaccgattacggcctgctg
gcgctctactccccgtcggacgtcaagacgctggtcgagaaattcagcacggagaacctg
cccgccgtggctgtcttcggcgaaggcacgctgcgcgccgcactcgacgccggaatcacc
gtactggccaacgcccccacgcccgaagccccgtcgatggtcaaggcgatcgacatctac
ctgaacaaggtgcagaaaggcgaggagatagcccccgtcgagttgattaccgacacgcag
aaagaggagttcatccgcagccaacagcacaagctggccaagaagagccgcgcacgccgt
cctgccgacccccgcaaataa

DBGET integrated database retrieval system